Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CYTOCHROME C551.5, NMR
 
Authors :  M. Assfalg, L. Banci, I. Bertini, M. Bruschi, P. Turano
Date :  10 Feb 98  (Deposition) - 29 Apr 98  (Release) - 26 Jan 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (35x)
Keywords :  Electron Transport, Cytochrome, Multiheme Cytochrome, Cytochrome C7 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Assfalg, L. Banci, I. Bertini, M. Bruschi, P. Turano
800 Mhz 1H Nmr Solution Structure Refinement Of Oxidized Cytochrome C7 From Desulfuromonas Acetoxidans.
Eur. J. Biochem. V. 256 261 1998
PubMed-ID: 9760163  |  Reference-DOI: 10.1046/J.1432-1327.1998.2560261.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C551.5
    Chains: A
    Organism Scientific: DESULFUROMONAS ACETOXIDANS
    Organism Taxid: 891
    Other Details: CLASS III OF C-TYPE CYTOCHROMES, FULLY OXIDIZED FORM
    Synonym: CYTOCHROME C7, TRIHEME CYTOCHROME

 Structural Features

(-) Chains, Units

  
NMR Structure (35x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

NMR Structure (1, 3)
No.NameCountTypeFull Name
1HEC3Ligand/IonHEME C

(-) Sites  (3, 3)

NMR Structure (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:6 , HIS A:17 , HIS A:20 , ALA A:21 , LEU A:24 , CYS A:26 , CYS A:29 , HIS A:30 , PRO A:34 , ALA A:35 , ILE A:37 , ILE A:39BINDING SITE FOR RESIDUE HEC A 69
2AC2SOFTWARETHR A:14 , PHE A:15 , HIS A:20 , LYS A:23 , LEU A:24 , CYS A:29 , ALA A:48 , CYS A:49 , CYS A:52 , HIS A:53 , ASN A:56 , ASN A:57 , CYS A:65BINDING SITE FOR RESIDUE HEC A 70
3AC3SOFTWAREASN A:8 , LYS A:9 , LYS A:10 , PHE A:15 , LYS A:41 , ALA A:44 , HIS A:45 , CYS A:49 , LYS A:50 , HIS A:53 , CYS A:62 , CYS A:65 , HIS A:66BINDING SITE FOR RESIDUE HEC A 71

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NEW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NEW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NEW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NEW)

(-) Exons   (0, 0)

(no "Exon" information available for 1NEW)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:68
 aligned with CYC3_DESAC | P00137 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:68
                                    10        20        30        40        50        60        
            CYC3_DESAC    1 ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK 68
               SCOP domains d1newa_ A: Cytochrome c7 (cytochrome c551.5, PpcA)                   SCOP domains
               CATH domains 1newA00 A:1-68 Cytochrome C3                                         CATH domains
               Pfam domains Cytochrom_CIII-1newA01 A:1-68                                        Pfam domains
         Sec.struct. author ..eeee......eeee.hhhhhhh............................................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                  1new A  1 ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK 68
                                    10        20        30        40        50        60
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Multiheme_cytos (34)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (CYC3_DESAC | P00137)
molecular function
    GO:0009055    electron transfer activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1new)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1new
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC3_DESAC | P00137
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYC3_DESAC | P00137
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYC3_DESAC | P00137: 1ehj 1f22 1hh5 1kwj 1l3o 1lm2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1NEW)