|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)
Sites (3, 3)
NMR Structure (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1LM2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1LM2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LM2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1LM2) |
Exons (0, 0)| (no "Exon" information available for 1LM2) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:68 aligned with CYC3_DESAC | P00137 from UniProtKB/Swiss-Prot Length:68 Alignment length:68 10 20 30 40 50 60 CYC3_DESAC 1 ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK 68 SCOP domains d1lm2a_ A: Cytochrome c7 (cytochrome c551.5, PpcA) SCOP domains CATH domains 1lm2A00 A:1-68 Cytochrome C3 CATH domains Pfam domains Cytochrom_CIII-1lm2A01 A:1-68 Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 1lm2 A 1 ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK 68 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (CYC3_DESAC | P00137)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|