|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KS0) |
Sites (0, 0)| (no "Site" information available for 2KS0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KS0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KS0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KS0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KS0) |
Exons (0, 0)| (no "Exon" information available for 2KS0) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:66 aligned with Q251Q8_DESHY | Q251Q8 from UniProtKB/TrEMBL Length:97 Alignment length:71 29 39 49 59 69 79 89 Q251Q8_DESHY 20 MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPRNSGSRQN 90 SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2ks0 A 1 MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLG-----LKAGQVEVEGLIDALVYPLEHHHHHH 71 10 20 30 40 | 50 60 70 40 46 Chain B from PDB Type:PROTEIN Length:66 aligned with Q251Q8_DESHY | Q251Q8 from UniProtKB/TrEMBL Length:97 Alignment length:71 29 39 49 59 69 79 89 Q251Q8_DESHY 20 MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPRNSGSRQN 90 SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------- CATH domains Pfam domains (1) YabP-2ks0B01 B:1-63 -------- Pfam domains (1) Pfam domains (2) YabP-2ks0B02 B:1-63 -------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2ks0 B 1 MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLG-----LKAGQVEVEGLIDALVYPLEHHHHHH 71 10 20 30 40 | 50 60 70 40 46
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KS0) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KS0) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2KS0)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|