|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2KEK) |
(no "Site" information available for 2KEK) |
NMR Structure
|
(no "Cis Peptide Bond" information available for 2KEK) |
(no "SAP(SNP)/Variant" information available for 2KEK) |
NMR Structure (2, 4)
|
(no "Exon" information available for 2KEK) |
NMR StructureChain A from PDB Type:PROTEIN Length:62 aligned with LACI_ECOLI | P03023 from UniProtKB/Swiss-Prot Length:360 Alignment length:62 10 20 30 40 50 60 LACI_ECOLI 1 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL 62 SCOP domains d2keka_ A: Lac repressor (LacR), N-terminal domain SCOP domains CATH domains 2kekA00 A:1-62 lambda repressor-like DNA-binding domains CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---HTH_LACI_2 PDB: A:4-58 UniProt: 4-58 ---- PROSITE (1) PROSITE (2) -----HTH_LACI_1 -------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------- Transcript 2kek A 1 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL 62 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:62 aligned with LACI_ECOLI | P03023 from UniProtKB/Swiss-Prot Length:360 Alignment length:62 10 20 30 40 50 60 LACI_ECOLI 1 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL 62 SCOP domains d2kekb_ B: Lac repressor (LacR), N-terminal domain SCOP domains CATH domains 2kekB00 B:1-62 lambda repressor-like DNA-binding domains CATH domains Pfam domains (1) ----LacI-2kekB01 B:5-50 ------------ Pfam domains (1) Pfam domains (2) ----LacI-2kekB02 B:5-50 ------------ Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---HTH_LACI_2 PDB: B:4-58 UniProt: 4-58 ---- PROSITE (1) PROSITE (2) -----HTH_LACI_1 -------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------- Transcript 2kek B 1 MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL 62 10 20 30 40 50 60 Chain C from PDB Type:DNA Length:23 2kek C -1 CGGCAGTGAGCGCAACGCAATTC 22 || 9 19 -1| 1 Chain D from PDB Type:DNA Length:23 2kek D -1 GAATTGCGTTGCGCTCACTGCCG 22 || 9 19 -1| 1
|
NMR Structure
|
NMR Structure
|
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (LACI_ECOLI | P03023)
|
|
|
|
|
|
|