|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2JM5) |
(no "Site" information available for 2JM5) |
(no "SS Bond" information available for 2JM5) |
(no "Cis Peptide Bond" information available for 2JM5) |
(no "SAP(SNP)/Variant" information available for 2JM5) |
NMR Structure (1, 1)
|
NMR Structure (4, 4)
|
NMR StructureChain A from PDB Type:PROTEIN Length:134 aligned with RGS18_HUMAN | Q9NS28 from UniProtKB/Swiss-Prot Length:235 Alignment length:134 82 92 102 112 122 132 142 152 162 172 182 192 202 RGS18_HUMAN 73 TRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRP 206 SCOP domains --d2jm5a1 A:3-134 Regulator of G-protein signaling 18, RGS18 SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------RGS PDB: A:14-130 UniProt: 86-202 ---- PROSITE Transcript 1 (1) 1.--------------------Exon 1.6b PDB: A:23-78 UniProt: 95-150 Exon 1.7 PDB: A:79-134 UniProt: 151-235 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) -Exon 1.3a PDB: A:2-23--------------------------------------------------------------------------------------------------------------- Transcript 1 (2) 2jm5 A 1 SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRP 134 10 20 30 40 50 60 70 80 90 100 110 120 130
|
NMR Structure
|
(no "CATH Domain" information available for 2JM5) |
(no "Pfam Domain" information available for 2JM5) |
NMR Structure(hide GO term definitions) Chain A (RGS18_HUMAN | Q9NS28)
|
|
|
|
|
|
|