|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 5)
|
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 2H9C) |
(no "Cis Peptide Bond" information available for 2H9C) |
(no "SAP(SNP)/Variant" information available for 2H9C) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 2H9C) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:88 aligned with PCHB_PSEAE | Q51507 from UniProtKB/Swiss-Prot Length:101 Alignment length:96 10 20 30 40 50 60 70 80 90 PCHB_PSEAE 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQ 96 SCOP domains d2h9ca_ A: Salicylate biosynthesis protei n PchB SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---CHORISMATE_MUT_2 PDB: A:4-94 UniProt: 4-94 -- PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 2h9c A 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRF--------APERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQ 96 10 20 30 40| 50 60 70 80 90 41 50 Chain B from PDB Type:PROTEIN Length:85 aligned with PCHB_PSEAE | Q51507 from UniProtKB/Swiss-Prot Length:101 Alignment length:92 10 20 30 40 50 60 70 80 90 PCHB_PSEAE 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK 92 SCOP domains d2h9cb_ B: Salicylate biosynthesis protei n PchB SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---CHORISMATE_MUT_2 PDB: B:4-92 UniProt: 4-94 PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2h9c B 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRF-------PAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK 92 10 20 30 40| 50 60 70 80 90 41 49
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2H9C) |
(no "Pfam Domain" information available for 2H9C) |
Asymmetric Unit(hide GO term definitions) Chain A,B (PCHB_PSEAE | Q51507)
|
|
|
|
|
|
|