|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 5)
Asymmetric Unit (1, 5)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2H9C) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2H9C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2H9C) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2H9C) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:88 aligned with PCHB_PSEAE | Q51507 from UniProtKB/Swiss-Prot Length:101 Alignment length:96 10 20 30 40 50 60 70 80 90 PCHB_PSEAE 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQ 96 SCOP domains d2h9ca_ A: Salicylate biosynthesis protei n PchB SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---CHORISMATE_MUT_2 PDB: A:4-94 UniProt: 4-94 -- PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 2h9c A 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRF--------APERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQ 96 10 20 30 40| 50 60 70 80 90 41 50 Chain B from PDB Type:PROTEIN Length:85 aligned with PCHB_PSEAE | Q51507 from UniProtKB/Swiss-Prot Length:101 Alignment length:92 10 20 30 40 50 60 70 80 90 PCHB_PSEAE 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK 92 SCOP domains d2h9cb_ B: Salicylate biosynthesis protei n PchB SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---CHORISMATE_MUT_2 PDB: B:4-92 UniProt: 4-94 PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2h9c B 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRF-------PAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK 92 10 20 30 40| 50 60 70 80 90 41 49
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2H9C) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2H9C) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (PCHB_PSEAE | Q51507)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|