|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric/Biological Unit (2, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3RET) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3RET) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3RET) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3RET) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:97 aligned with PCHB_PSEAE | Q51507 from UniProtKB/Swiss-Prot Length:101 Alignment length:97 10 20 30 40 50 60 70 80 90 PCHB_PSEAE 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQT 97 SCOP domains d3reta_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---CHORISMATE_MUT_2 PDB: A:4-94 UniProt: 4-94 --- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 3ret A 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFEASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQT 97 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:91 aligned with PCHB_PSEAE | Q51507 from UniProtKB/Swiss-Prot Length:101 Alignment length:97 10 20 30 40 50 60 70 80 90 PCHB_PSEAE 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQT 97 SCOP domains d3retb_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---CHORISMATE_MUT_2 PDB: B:4-94 UniProt: 4-94 --- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 3ret B 1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRF------IPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQT 97 10 20 30 40| |50 60 70 80 90 41 48
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3RET) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3RET) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (PCHB_PSEAE | Q51507)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|