|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 10)
Asymmetric Unit (4, 10)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2H28) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2H28) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2H28) |
Exons (0, 0)| (no "Exon" information available for 2H28) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:109 aligned with CBEA_ECOLI | P76364 from UniProtKB/Swiss-Prot Length:122 Alignment length:109 122 25 35 45 55 65 75 85 95 105 115 | CBEA_ECOLI 16 DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN-- - SCOP domains d2h28a1 A:16-122 Hypothetical protein YeeU -- SCOP domains CATH domains -----------2h28A01 A:27-118 [code=3.30.450.20, no name defined] ------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 2h28 A 16 DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLmKQLELmLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEmKNLE 124 25 35 45 55 65 | 75| 85 95 105 115 | 70-MSE | 120-MSE 76-MSE Chain B from PDB Type:PROTEIN Length:104 aligned with CBEA_ECOLI | P76364 from UniProtKB/Swiss-Prot Length:122 Alignment length:104 24 34 44 54 64 74 84 94 104 114 CBEA_ECOLI 15 HDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTP 118 SCOP domains d2h28b_ B: Hypothetical protein YeeU SCOP domains CATH domains ------------2h28B01 B:27-118 [code=3.30.450.20, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 2h28 B 15 HDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLmKQLELmLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTP 118 24 34 44 54 64 | 74 | 84 94 104 114 70-MSE | 76-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2H28) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (CBEA_ECOLI | P76364)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|