|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric/Biological Unit (2, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2G8F) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2G8F) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2G8F) |
Exons (0, 0)| (no "Exon" information available for 2G8F) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:133 aligned with RNH1_BACHD | Q9KEI9 from UniProtKB/Swiss-Prot Length:196 Alignment length:133 70 80 90 100 110 120 130 140 150 160 170 180 190 RNH1_BACHD 61 EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY 193 SCOP domains d2g8fa1 A:61-193 BH0863-like Ribonuclease H SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript 2g8f A 61 EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY 193 70 80 90 100 110 120 130 140 150 160 170 180 190
Chain B from PDB Type:RNA Length:6
2g8f B 1 UCGACA 6
Chain C from PDB Type:DNA Length:6
2g8f C 1 ATGTCG 6
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2G8F) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2G8F) |
Gene Ontology (9, 9)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RNH1_BACHD | Q9KEI9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|