|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2COQ) |
Sites (0, 0)| (no "Site" information available for 2COQ) |
SS Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2COQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2COQ) |
Exons (0, 0)| (no "Exon" information available for 2COQ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:108 aligned with Q8JJ25_9CHON | Q8JJ25 from UniProtKB/TrEMBL Length:108 Alignment length:108 10 20 30 40 50 60 70 80 90 100 Q8JJ25_9CHON 1 ARVDQTPRIATKETGESLTINCVLRDTACALDSTNWYRTKLGSTKEQTISIGGRYSETVDEGSNSASLTIRDLRVEDSGTYKCKAYRRCAFNTGVGYKEGAGTVLTVK 108 SCOP domains d2coqa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2coq A 1 ARVDQTPRIATKETGESLTINCVLRDTACALDSTNWYRTKLGSTKEQTISIGGRYSETVDEGSNSASLTIRDLRVEDSGTYKCKAYRRCAFNTGVGYKEGAGTVLTVK 108 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2COQ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2COQ) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2COQ)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|