|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1VES) |
Sites (0, 0)| (no "Site" information available for 1VES) |
SS Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
Cis Peptide Bonds (4, 4)
Asymmetric Unit
|
||||||||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VES) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VES) |
Exons (0, 0)| (no "Exon" information available for 1VES) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:113 aligned with Q6X1E6_9CHON | Q6X1E6 from UniProtKB/TrEMBL Length:113 Alignment length:113 10 20 30 40 50 60 70 80 90 100 110 Q6X1E6_9CHON 1 AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK 113 SCOP domains d1vesa_ A: Novel antigen receptor 12Y-2 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------- Transcript 1ves A 1 AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK 113 10 20 30 40 50 60 70 80 90 100 110 Chain B from PDB Type:PROTEIN Length:113 aligned with Q6X1E6_9CHON | Q6X1E6 from UniProtKB/TrEMBL Length:113 Alignment length:113 10 20 30 40 50 60 70 80 90 100 110 Q6X1E6_9CHON 1 AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK 113 SCOP domains d1vesb_ B: Novel antigen receptor 12Y-2 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) V-set-1vesB01 B:1-112 - Pfam domains (1) Pfam domains (2) V-set-1vesB02 B:1-112 - Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------- Transcript 1ves B 1 AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK 113 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1VES) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1VES)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|