2CLY - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   SUBCOMPLEX OF THE STATOR OF BOVINE MITOCHONDRIAL ATP SYNTHASE

Authors :   V. Kane Dickson, J. A. Silvester, I. M. Fearnley, A. G. W. Leslie, J. E. Walker

Date :   03 May 06 (Deposition) - 28 Jun 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,C  (1x)
Biol. Unit 2: D,E,F  (1x)

Keywords :   Mitochondria, Mitochondrion, Ion Transport, Cf(0), Stator, Transport, Acetylation, Atp Synthase, Hydrogen Ion Transport, Transit Peptide, Peripheral Stalk, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. Kane Dickson, J. A. Silvester, I. M. Fearnley, A. G. W. Leslie, J. E. Walker
On The Structure Of The Stator Of The Mitochondrial Atp Synthase.
Embo J. V. 25 2911 2006
PubMed-ID: 16791136 | Reference-DOI: 10.1038/SJ.EMBOJ.7601177
(for further references see the PDB file header)

Molecule 1 - ATP SYNTHASE B CHAIN, MITOCHONDRIAL
	Chains	:	A, D
	EC Number	:	3.6.3.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	C41 (DE3)
	Expression System Taxid	:	562
	Fragment	:	STATOR SUBCOMPLEX
	Organ	:	HEART
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

Molecule 2 - ATP SYNTHASE D CHAIN, MITOCHONDRIAL
	Chains	:	B, E
	EC Number	:	3.6.3.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	C41 (DE3)
	Expression System Taxid	:	562
	Fragment	:	STATOR SUBCOMPLEX
	Organ	:	HEART
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

Molecule 3 - ATP SYNTHASE COUPLING FACTOR 6, MITOCHONDRIAL
	Chains	:	C, F
	EC Number	:	3.6.3.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	C41 (DE3)
	Expression System Taxid	:	562
	Fragment	:	STATOR SUBCOMPLEX
	Organ	:	HEART
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B	C
Biological Unit 2 (1x)	:				D	E	F

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2CLY)

(no "Site" information available for 2CLY)

(no "SS Bond" information available for 2CLY)

(no "Cis Peptide Bond" information available for 2CLY)

(no "SAP(SNP)/Variant" information available for 2CLY)

(no "PROSITE Motif" information available for 2CLY)

Asymmetric Unit (11, 22)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000008447	1	ENSBTAE00000366545	chr3:34439903-34439828	76	AT5F1_BOVIN	1-14	14	0	-	-
1.2	ENSBTAT00000008447	2	ENSBTAE00000387804	chr3:34439648-34439612	37	AT5F1_BOVIN	14-26	13	0	-	-
1.3	ENSBTAT00000008447	3	ENSBTAE00000428584	chr3:34433047-34432902	146	AT5F1_BOVIN	26-75	50	0	-	-
1.4	ENSBTAT00000008447	4	ENSBTAE00000068331	chr3:34429919-34429756	164	AT5F1_BOVIN	75-129	55	2	A:79-87 D:79-87	9 9
1.5	ENSBTAT00000008447	5	ENSBTAE00000068333	chr3:34429411-34429286	126	AT5F1_BOVIN	130-171	42	2	A:88-129 D:88-129	42 42
1.6	ENSBTAT00000008447	6	ENSBTAE00000068340	chr3:34425878-34425699	180	AT5F1_BOVIN	172-231	60	2	A:130-183 D:130-183	54 54
1.7	ENSBTAT00000008447	7	ENSBTAE00000068343	chr3:34423268-34422853	416	AT5F1_BOVIN	232-256	25	0	-	-

2.1	ENSBTAT00000028282	1	ENSBTAE00000295799	chr19:58014852-58014901	50	ATP5H_BOVIN	-	0	0	-	-
2.2	ENSBTAT00000028282	2	ENSBTAE00000231040	chr19:58016320-58016449	130	ATP5H_BOVIN	1-41	41	2	B:4-40 E:3-40	37 38
2.3	ENSBTAT00000028282	3	ENSBTAE00000231042	chr19:58016723-58016819	97	ATP5H_BOVIN	41-73	33	2	B:40-72 E:40-72	33 33
2.4	ENSBTAT00000028282	4	ENSBTAE00000231043	chr19:58018243-58018314	72	ATP5H_BOVIN	74-97	24	2	B:73-96 E:73-96	24 24
2.5	ENSBTAT00000028282	5	ENSBTAE00000231044	chr19:58019205-58019267	63	ATP5H_BOVIN	98-118	21	2	B:97-117 E:97-117	21 21
2.6	ENSBTAT00000028282	6	ENSBTAE00000231046	chr19:58019418-58019617	200	ATP5H_BOVIN	119-161	43	2	B:118-123 E:118-123	6 6

3.1	ENSBTAT00000032427	1	ENSBTAE00000259413	chr1:10042456-10042499	44	ATP5J_BOVIN	-	0	0	-	-
3.2	ENSBTAT00000032427	2	ENSBTAE00000006048	chr1:10045981-10046151	171	ATP5J_BOVIN	1-55	55	2	C:5-24 F:5-24	20 20
3.3	ENSBTAT00000032427	3	ENSBTAE00000006056	chr1:10048867-10048991	125	ATP5J_BOVIN	55-97	43	2	C:24-66 F:24-66	43 43
3.4	ENSBTAT00000032427	4	ENSBTAE00000006057	chr1:10049596-10049771	176	ATP5J_BOVIN	97-108	12	2	C:66-70 F:66-70	5 5

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:105
 aligned with AT5F1_BOVIN | P13619 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:105
                                   130       140       150       160       170       180       190       200       210       220     
          AT5F1_BOVIN   121 GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ 225
               SCOP domains d2clya1 A:79-183 ATP synthase subunit b, mitochondrial                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4 Exon 1.5  PDB: A:88-129 UniProt: 130-171  Exon 1.6  PDB: A:130-183 UniProt: 172-231 [INCOMPLETE] Transcript 1
                 2cly A  79 GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ 183
                                    88        98       108       118       128       138       148       158       168       178

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with ATP5H_BOVIN | P13620 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:120
                                    14        24        34        44        54        64        74        84        94       104       114       124
          ATP5H_BOVIN     5 KLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN 124
               SCOP domains d2clyb1 B:4-123 ATP synthase subunit d, mitochondrial                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh....hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.2  PDB: B:4-40 UniProt: 1-41  --------------------------------Exon 2.4  PDB: B:73-96  Exon 2.5             2.6    Transcript 2 (1)
           Transcript 2 (2) ------------------------------------Exon 2.3  PDB: B:40-72           --------------------------------------------------- Transcript 2 (2)
                 2cly B   4 KLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN 123
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain C from PDB  Type:PROTEIN  Length:66
 aligned with ATP5J_BOVIN | P02721 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:66
                                    45        55        65        75        85        95      
          ATP5J_BOVIN    36 LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE 101
               SCOP domains d2clyc_ C: ATPase subunit F6                                       SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
           Transcript 3 (1) Exon 3.2  PDB: C:5-2-----------------------------------------3.4   Transcript 3 (1)
           Transcript 3 (2) -------------------Exon 3.3  PDB: C:24-66 UniProt: 55-97      ---- Transcript 3 (2)
                 2cly C   5 LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE  70
                                    14        24        34        44        54        64

Chain D from PDB  Type:PROTEIN  Length:105
 aligned with AT5F1_BOVIN | P13619 from UniProtKB/Swiss-Prot  Length:256

    Alignment length:105
                                   130       140       150       160       170       180       190       200       210       220     
          AT5F1_BOVIN   121 GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ 225
               SCOP domains d2clyd_ D: ATP synthase subunit b, mitochondrial                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4 Exon 1.5  PDB: D:88-129 UniProt: 130-171  Exon 1.6  PDB: D:130-183 UniProt: 172-231 [INCOMPLETE] Transcript 1
                 2cly D  79 GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ 183
                                    88        98       108       118       128       138       148       158       168       178

Chain E from PDB  Type:PROTEIN  Length:121
 aligned with ATP5H_BOVIN | P13620 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:121
                                    13        23        33        43        53        63        73        83        93       103       113       123 
          ATP5H_BOVIN     4 RKLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN 124
               SCOP domains d2clye_ E: ATP synthase subunit d, mitochondrial                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh...hhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2  PDB: E:3-40 UniProt: 1-41   --------------------------------Exon 2.4  PDB: E:73-96  Exon 2.5             2.6    Transcript 2 (1)
           Transcript 2 (2) -------------------------------------Exon 2.3  PDB: E:40-72           --------------------------------------------------- Transcript 2 (2)
                 2cly E   3 RKLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN 123
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain F from PDB  Type:PROTEIN  Length:66
 aligned with ATP5J_BOVIN | P02721 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:66
                                    45        55        65        75        85        95      
          ATP5J_BOVIN    36 LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE 101
               SCOP domains d2clyf_ F: ATPase subunit F6                                       SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
           Transcript 3 (1) Exon 3.2  PDB: F:5-2-----------------------------------------3.4   Transcript 3 (1)
           Transcript 3 (2) -------------------Exon 3.3  PDB: F:24-66 UniProt: 55-97      ---- Transcript 3 (2)
                 2cly F   5 LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE  70
                                    14        24        34        44        54        64

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 2CLY)

(no "Pfam Domain" information available for 2CLY)

Asymmetric Unit(hide GO term definitions)

Chain A,D (AT5F1_BOVIN | P13619)

molecular function
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0015078	hydrogen ion transmembrane transporter activity	Enables the transfer of hydrogen ions from one side of a membrane to the other.
	GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
biological process
	GO:0015986	ATP synthesis coupled proton transport	The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0021762	substantia nigra development	The progression of the substantia nigra over time from its initial formation until its mature state. The substantia nigra is the layer of gray substance that separates the posterior parts of the cerebral peduncles (tegmentum mesencephali) from the anterior parts; it normally includes a posterior compact part with many pigmented cells (pars compacta) and an anterior reticular part whose cells contain little pigment (pars reticularis).
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005753	mitochondrial proton-transporting ATP synthase complex	A proton-transporting ATP synthase complex found in the mitochondrial membrane.
	GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	All non-F1 subunits of the mitochondrial hydrogen-transporting ATP synthase, including integral and peripheral mitochondrial inner membrane proteins.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	All non-F1 subunits of a hydrogen-transporting ATP synthase, including integral and peripheral membrane proteins.

Chain B,E (ATP5H_BOVIN | P13620)

molecular function
	GO:0015078	hydrogen ion transmembrane transporter activity	Enables the transfer of hydrogen ions from one side of a membrane to the other.
biological process
	GO:0015986	ATP synthesis coupled proton transport	The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005753	mitochondrial proton-transporting ATP synthase complex	A proton-transporting ATP synthase complex found in the mitochondrial membrane.
	GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	All non-F1 subunits of the mitochondrial hydrogen-transporting ATP synthase, including integral and peripheral mitochondrial inner membrane proteins.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	All non-F1 subunits of a hydrogen-transporting ATP synthase, including integral and peripheral membrane proteins.

Chain C,F (ATP5J_BOVIN | P02721)

molecular function
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0015078	hydrogen ion transmembrane transporter activity	Enables the transfer of hydrogen ions from one side of a membrane to the other.
biological process
	GO:0015986	ATP synthesis coupled proton transport	The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0021762	substantia nigra development	The progression of the substantia nigra over time from its initial formation until its mature state. The substantia nigra is the layer of gray substance that separates the posterior parts of the cerebral peduncles (tegmentum mesencephali) from the anterior parts; it normally includes a posterior compact part with many pigmented cells (pars compacta) and an anterior reticular part whose cells contain little pigment (pars reticularis).
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005753	mitochondrial proton-transporting ATP synthase complex	A proton-transporting ATP synthase complex found in the mitochondrial membrane.
	GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	All non-F1 subunits of the mitochondrial hydrogen-transporting ATP synthase, including integral and peripheral mitochondrial inner membrane proteins.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	All non-F1 subunits of a hydrogen-transporting ATP synthase, including integral and peripheral membrane proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cly)

	Sites
(no "Sites" information available for 2cly)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cly)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2cly
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AT5F1_BOVIN \| P13619
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ATP5H_BOVIN \| P13620
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ATP5J_BOVIN \| P02721
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AT5F1_BOVIN \| P13619
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ATP5H_BOVIN \| P13620
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ATP5J_BOVIN \| P02721
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AT5F1_BOVIN \| P13619	:	2wss 4b2q 5ara 5are 5arh 5ari 5fij 5fik 5fil
	ATP5H_BOVIN \| P13620	:	2wss 4b2q 5ara 5are 5arh 5ari 5fij 5fik 5fil
	ATP5J_BOVIN \| P02721	:	1vzs 2wss 4b2q 5ara 5are 5arh 5ari 5fij 5fik 5fil

1vzs	SOLUTION STRUCTURE OF SUBUNIT F6 FROM THE PERIPHERAL STALK REGION OF ATP SYNTHASE FROM BOVINE HEART MITOCHONDRIA

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (11, 22)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 6)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (18, 42)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File