2BO5 - JenaLib

Title :   BOVINE OLIGOMYCIN SENSITIVITY CONFERRAL PROTEIN N-TERMINAL DOMAIN

Authors :   R. J. Carbajo, F. A. Kellas, M. J. Runswick, M. G. Montgomery, J. E. Walker, D. Neuhaus

Date :   07 Apr 05 (Deposition) - 17 Aug 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (44x)

Keywords :   Atp Synthase, Peripheral Stalk, Oscp, Alpha-Subunit, Beta- Subunit, Nmr, Protein-Protein Interactions, Chemical Shift Perturbations, Chemical Shift Mapping, Titration, Binding Interface, Cf(1), Hydrogen Ion Transport, Hydrolase, Ion Transport, Mitochondrion, Transit Peptide, Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. J. Carbajo, F. A. Kellas, M. J. Runswick, M. G. Montgomery, J. E. Walker, D. Neuhaus
Structure Of The F(1)-Binding Domain Of The Stator Of Bovine F(1)F(O)-Atpase And How It Binds An Alpha-Subunit.
J. Mol. Biol. V. 351 824 2005
PubMed-ID: 16045926 | Reference-DOI: 10.1016/J.JMB.2005.06.012

Compounds

Molecule 1 - ATP SYNTHASE OLIGOMYCIN SENSITIVITY CONFERRAL PROTEIN
	Chains	:	A
	EC Number	:	3.6.3.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-10, PET-11
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	N-TERMINAL DOMAIN, RESIDUES 24-143
	Organ	:	HEART
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Other Details	:	MITOCHONDRIAL
	Synonym	:	OSCP

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000024326	1	ENSBTAE00000197898	chr1:720699-720764	66	ATPO_BOVIN	1-12	12	0	-	-
1.2	ENSBTAT00000024326	2	ENSBTAE00000401349	chr1:722101-722151	51	ATPO_BOVIN	13-29	17	1	A:1-6	6
1.3	ENSBTAT00000024326	3	ENSBTAE00000197900	chr1:723098-723208	111	ATPO_BOVIN	30-66	37	1	A:7-43	37
1.4	ENSBTAT00000024326	4	ENSBTAE00000197901	chr1:725362-725491	130	ATPO_BOVIN	67-110	44	1	A:44-87	44
1.5	ENSBTAT00000024326	5	ENSBTAE00000197902	chr1:726174-726286	113	ATPO_BOVIN	110-147	38	1	A:87-120	34
1.6	ENSBTAT00000024326	6	ENSBTAE00000398411	chr1:727512-727598	87	ATPO_BOVIN	148-176	29	0	-	-
1.7	ENSBTAT00000024326	7	ENSBTAE00000197904	chr1:727876-728057	182	ATPO_BOVIN	177-213	37	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:120
 aligned with ATPO_BOVIN | P13621 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:120
                                    33        43        53        63        73        83        93       103       113       123       133       143
           ATPO_BOVIN    24 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhh.........hhhhhhh.......hhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.2   Exon 1.3  PDB: A:7-43 UniProt: 30-66 Exon 1.4  PDB: A:44-87 UniProt: 67-110      --------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------Exon 1.5  PDB: A:87-120            Transcript 1 (2)
                 2bo5 A   1 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV 120
                                    10        20        30        40        50        60        70        80        90       100       110       120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

NMR Structure(hide GO term definitions)

Chain A (ATPO_BOVIN | P13621)

molecular function
	GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
biological process
	GO:0006754	ATP biosynthetic process	The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0015986	ATP synthesis coupled proton transport	The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005753	mitochondrial proton-transporting ATP synthase complex	A proton-transporting ATP synthase complex found in the mitochondrial membrane.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2bo5)

	Sites
(no "Sites" information available for 2bo5)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bo5)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2bo5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ATPO_BOVIN \| P13621
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ATPO_BOVIN \| P13621
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description