|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (4, 5)
|
Asymmetric Unit (5, 5)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2ALG) |
(no "SAP(SNP)/Variant" information available for 2ALG) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 2ALG) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:92 aligned with NLTP1_PRUPE | P81402 from UniProtKB/Swiss-Prot Length:91 Alignment length:92 1 | 9 19 29 39 49 59 69 79 89 NLTP1_PRUPE - -ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91 SCOP domains d2alga_ A: automated matches SCOP domains CATH domains 2algA00 A:0-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------PLANT_LTP PDB: A:69-9- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2alg A 0 MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK 91 9 19 29 39 49 59 69 79 89 Chain B from PDB Type:PROTEIN Length:92 aligned with NLTP1_PRUPE | P81402 from UniProtKB/Swiss-Prot Length:91 Alignment length:92 1 | 9 19 29 39 49 59 69 79 89 NLTP1_PRUPE - -ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91 SCOP domains d2algb_ B: automated matches SCOP domains CATH domains 2algB00 B:0-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------PLANT_LTP PDB: B:69-9- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2alg B 0 MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK 91 9 19 29 39 49 59 69 79 89
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2ALG) |
Asymmetric Unit(hide GO term definitions) Chain A,B (NLTP1_PRUPE | P81402)
|
|
|
|
|
|
|