|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 3) Biological Unit 1 (2, 6) |
Asymmetric Unit (3, 3)
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 4)
|
Asymmetric Unit (4, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:124 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot Length:152 Alignment length:124 34 44 54 64 74 84 94 104 114 124 134 144 AVID_CHICK 25 ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLR 148 SCOP domains d2a5ba_ A: automated matches SCOP domains CATH domains 2a5bA00 A:1-124 [code=2.40.128.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------T------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -AVIDIN_2 PDB: A:2-124 UniProt: 26-149 PROSITE (1) PROSITE (2) -----------------------------------------------------------------------------------------------------------AVIDIN_1 -- PROSITE (2) Transcript 1 (1) 1.1Exon 1.4 PDB: A:4-74 UniProt: 28-98 ---------------------------------------Exon 1.6a Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------------------------Exon 1.5 PDB: A:74-114 UniProt: 98-138 ---------- Transcript 1 (2) 2a5b A 1 ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLR 124 10 20 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:124 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot Length:152 Alignment length:124 34 44 54 64 74 84 94 104 114 124 134 144 AVID_CHICK 25 ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLR 148 SCOP domains d2a5bb_ B: automated matches SCOP domains CATH domains 2a5bB00 B:1-124 [code=2.40.128.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------T------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -AVIDIN_2 PDB: B:2-124 UniProt: 26-149 PROSITE (1) PROSITE (2) -----------------------------------------------------------------------------------------------------------AVIDIN_1 -- PROSITE (2) Transcript 1 (1) 1.1Exon 1.4 PDB: B:4-74 UniProt: 28-98 ---------------------------------------Exon 1.6a Transcript 1 (1) Transcript 1 (2) -------------------------------------------------------------------------Exon 1.5 PDB: B:74-114 UniProt: 98-138 ---------- Transcript 1 (2) 2a5b B 1 ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLR 124 10 20 30 40 50 60 70 80 90 100 110 120
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2A5B) |
Asymmetric Unit(hide GO term definitions) Chain A,B (AVID_CHICK | P02701)
|
|
|
|
|
|
|