Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE PARKIA PLATYCEPHALA SEED LECTIN
 
Authors :  F. Gallego Del Sol, B. S. Cavada, J. J. Calvete
Date :  22 Apr 05  (Deposition) - 11 Oct 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Beta-Prism, Lectin, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Gallego Del Sol, C. Nagano, B. S. Cavada, J. J. Calvete
The First Crystal Structure Of A Mimosoideae Lectin Reveals A Novel Quaternary Arrangement Of A Widespread Domain.
J. Mol. Biol. V. 353 574 2005
PubMed-ID: 16185708  |  Reference-DOI: 10.1016/J.JMB.2005.08.055
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MANNOSE/GLUCOSE-SPECIFIC LECTIN
    ChainsA, B
    Organism ScientificPARKIA PLATYCEPHALA
    Organism Taxid185447
    TissueSEEDS

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZGR)

(-) Sites  (0, 0)

(no "Site" information available for 1ZGR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZGR)

(-) Cis Peptide Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1Gly A:9 -Pro A:10
2Trp A:74 -Pro A:75
3Gly A:108 -Pro A:109
4Gly A:157 -Pro A:158
5Gly A:255 -Pro A:256
6Gly A:304 -Pro A:305
7Trp A:367 -Pro A:368
8Gly A:404 -Pro A:405
9Gly B:9 -Pro B:10
10Trp B:74 -Pro B:75
11Gly B:108 -Pro B:109
12Gly B:157 -Pro B:158
13Gly B:255 -Pro B:256
14Gly B:304 -Pro B:305
15Trp B:367 -Pro B:368
16Gly B:404 -Pro B:405

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 6)

Asymmetric/Biological Unit (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_LEC_PARPC_001 *I70VLEC_PARPC  ---  ---A/BI70V
2UniProtVAR_LEC_PARPC_002 *K227RLEC_PARPC  ---  ---A/BK227R
3UniProtVAR_LEC_PARPC_003 *D296NLEC_PARPC  ---  ---A/BD296N
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 6)

Asymmetric/Biological Unit (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1JACALIN_LECTINPS51752 Jacalin-type lectin domain profile.LEC_PARPC5-148
 
153-294
 
300-443
 
  6A:5-148
B:5-148
A:153-294
B:153-294
A:300-443
B:300-443

(-) Exons   (0, 0)

(no "Exon" information available for 1ZGR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:441
 aligned with LEC_PARPC | P83304 from UniProtKB/Swiss-Prot  Length:447

    Alignment length:441
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443 
            LEC_PARPC     4 GMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1zgrA01 A:4-149  [code=2.100.10.30, no name defined]                                                                                              1zgrA02 A:150-295  [code=2.100.10.30, no name defined]                                                                                            1zgrA03 A:296-444  [code=2.100.10.30, no name defined]                                                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee..........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee.....eee...ee.eeeeeeeeee...eeeeeeeeee.....eeeeeee.....eeeeee....eeeeeeee...eeeeeeee....eeeeee........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeee..ee.eeeeeeeeee...eeeeeeeeee......eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee........eeeeee.......eeeeeeeeeeee...eeeeeeeeeeee...eeeeee....eeee..ee.eeeeeeeeee...eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------R--------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -JACALIN_LECTIN  PDB: A:5-148 UniProt: 5-148                                                                                                     ----JACALIN_LECTIN  PDB: A:153-294 UniProt: 153-294                                                                                               -----JACALIN_LECTIN  PDB: A:300-443 UniProt: 300-443                                                                                                 - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zgr A   4 GMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443 

Chain B from PDB  Type:PROTEIN  Length:441
 aligned with LEC_PARPC | P83304 from UniProtKB/Swiss-Prot  Length:447

    Alignment length:441
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443 
            LEC_PARPC     4 GMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1zgrB01 B:4-149  [code=2.100.10.30, no name defined]                                                                                              1zgrB02 B:150-295  [code=2.100.10.30, no name defined]                                                                                            1zgrB03 B:296-444  [code=2.100.10.30, no name defined]                                                                                                CATH domains
           Pfam domains (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgrB01 B:311-443                                                                                                            - Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgrB02 B:311-443                                                                                                            - Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgrB03 B:311-443                                                                                                            - Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgrB04 B:311-443                                                                                                            - Pfam domains (4)
           Pfam domains (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgrB05 B:311-443                                                                                                            - Pfam domains (5)
           Pfam domains (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgrB06 B:311-443                                                                                                            - Pfam domains (6)
         Sec.struct. author ..eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee..........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee.....eeee..ee.eeeeeeeeee...eeeeeeeeee......eeeeee.....eeeeee......eeeeee...eeeeeee.....eeeeee........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeee..ee.eeeeeeeeee.....eeeeeeee......eeeeeee....eeeeee....eeeeee........eeeee....................eeee.......eeeeeeeeeeee...eeeeeeeeeeee...ee........eeee..ee.eeeeeeeeee...eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------R--------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -JACALIN_LECTIN  PDB: B:5-148 UniProt: 5-148                                                                                                     ----JACALIN_LECTIN  PDB: B:153-294 UniProt: 153-294                                                                                               -----JACALIN_LECTIN  PDB: B:300-443 UniProt: 300-443                                                                                                 - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zgr B   4 GMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1ZGR)

(-) CATH Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 6)

Asymmetric/Biological Unit
1aJacalin-1zgrB01B:311-443
1bJacalin-1zgrB02B:311-443
1cJacalin-1zgrB03B:311-443
1dJacalin-1zgrB04B:311-443
1eJacalin-1zgrB05B:311-443
1fJacalin-1zgrB06B:311-443

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (LEC_PARPC | P83304)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0005536    glucose binding    Interacting selectively and non-covalently with the D- or L-enantiomer of glucose.
    GO:0005537    mannose binding    Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.
biological process
    GO:0000771    agglutination involved in conjugation    The aggregation or adhesion of compatible mating types via complementary cell-cell interactions prior to the formation of irreversible cellular contacts during conjugation.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1zgr)
 
  Sites
(no "Sites" information available for 1zgr)
 
  Cis Peptide Bonds
    Gly A:108 - Pro A:109   [ RasMol ]  
    Gly A:157 - Pro A:158   [ RasMol ]  
    Gly A:255 - Pro A:256   [ RasMol ]  
    Gly A:304 - Pro A:305   [ RasMol ]  
    Gly A:404 - Pro A:405   [ RasMol ]  
    Gly A:9 - Pro A:10   [ RasMol ]  
    Gly B:108 - Pro B:109   [ RasMol ]  
    Gly B:157 - Pro B:158   [ RasMol ]  
    Gly B:255 - Pro B:256   [ RasMol ]  
    Gly B:304 - Pro B:305   [ RasMol ]  
    Gly B:404 - Pro B:405   [ RasMol ]  
    Gly B:9 - Pro B:10   [ RasMol ]  
    Trp A:367 - Pro A:368   [ RasMol ]  
    Trp A:74 - Pro A:75   [ RasMol ]  
    Trp B:367 - Pro B:368   [ RasMol ]  
    Trp B:74 - Pro B:75   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zgr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LEC_PARPC | P83304
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LEC_PARPC | P83304
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LEC_PARPC | P833041zgs

(-) Related Entries Specified in the PDB File

1zgs THE SAME PROTEIN WITH XMM