1ZGS - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   PARKIA PLATYCEPHALA SEED LECTIN IN COMPLEX WITH 5-BROMO-4-CHLORO-3-INDOLYL-A-D-MANNOSE

Authors :   F. Gallego Del Sol, B. S. Cavada, J. J. Calvete

Date :   22 Apr 05 (Deposition) - 11 Oct 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym./Biol. Unit : A,B

Keywords :   Beta Prism, Lectin, X-Man, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. Gallego Del Sol, C. Nagano, B. S. Cavada, J. J. Calvete
The First Crystal Structure Of A Mimosoideae Lectin Reveals A Novel Quaternary Arrangement Of A Widespread Domain.
J. Mol. Biol. V. 353 574 2005
PubMed-ID: 16185708 | Reference-DOI: 10.1016/J.JMB.2005.08.055
(for further references see the PDB file header)

Molecule 1 - MANNOSE/GLUCOSE-SPECIFIC LECTIN
	Chains	:	A, B
	Organism Scientific	:	PARKIA PLATYCEPHALA
	Organism Taxid	:	185447
	Tissue	:	SEEDS

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 6)

No.	Name	Count	Type	Full Name
1	XMM	6	Ligand/Ion	(2R,3S,4S,5S,6R)-2-(5-BROMO-4-CHLORO-1H-INDOL-3-YLOXY)-TETRAHYDRO-6-(HYDROXYMETHYL)-2H-PYRAN-3,4,5-TRIOL

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:310 , GLY A:311 , PHE A:388 , GLY A:431 , ASP A:432 , TYR A:433 , ASP A:435 , HOH A:555 , XMM B:453	BINDING SITE FOR RESIDUE XMM A 450
2	AC2	SOFTWARE	ALA A:163 , GLY A:164 , ASP A:165 , PHE A:239 , GLY A:282 , TYR A:283 , TYR A:284 , ASP A:286 , HOH A:541	BINDING SITE FOR RESIDUE XMM A 451
3	AC3	SOFTWARE	GLY A:16 , ARG A:60 , GLY A:136 , TYR A:137 , TYR A:138 , ASP A:140 , ASP B:386 , XMM B:455	BINDING SITE FOR RESIDUE XMM A 452
4	AC4	SOFTWARE	ASP A:386 , XMM A:450 , GLY B:16 , ARG B:60 , GLY B:136 , TYR B:137 , TYR B:138 , ASP B:140	BINDING SITE FOR RESIDUE XMM B 453
5	AC5	SOFTWARE	ALA B:163 , GLY B:164 , ASP B:165 , PHE B:239 , GLY B:282 , TYR B:283 , TYR B:284 , ASP B:286 , HOH B:546	BINDING SITE FOR RESIDUE XMM B 454
6	AC6	SOFTWARE	ASN A:90 , XMM A:452 , GLY B:310 , GLY B:311 , PHE B:388 , GLY B:431 , ASP B:432 , TYR B:433 , ASP B:435 , HOH B:553	BINDING SITE FOR RESIDUE XMM B 455

(no "SS Bond" information available for 1ZGS)

Asymmetric/Biological Unit

No.	Residues
1	Gly A:9	-	Pro A:10
2	Trp A:74	-	Pro A:75
3	Gly A:108	-	Pro A:109
4	Gly A:157	-	Pro A:158
5	Gly A:255	-	Pro A:256
6	Gly A:304	-	Pro A:305
7	Trp A:367	-	Pro A:368
8	Gly A:404	-	Pro A:405
9	Gly B:9	-	Pro B:10
10	Trp B:74	-	Pro B:75
11	Gly B:108	-	Pro B:109
12	Gly B:157	-	Pro B:158
13	Gly B:255	-	Pro B:256
14	Gly B:304	-	Pro B:305
15	Trp B:367	-	Pro B:368
16	Gly B:404	-	Pro B:405

Asymmetric/Biological Unit (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LEC_PARPC_001 *	I	70	V	LEC_PARPC	---	---	A/B	I	70	V
2	UniProt	VAR_LEC_PARPC_002 *	K	227	R	LEC_PARPC	---	---	A/B	K	227	R
3	UniProt	VAR_LEC_PARPC_003 *	D	296	N	LEC_PARPC	---	---	A/B	D	296	N
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	JACALIN_LECTIN	PS51752	Jacalin-type lectin domain profile.	LEC_PARPC	5-148 153-294 300-443	6	A:5-148 B:5-148 A:153-294 B:153-294 A:300-443 B:300-443

(no "Exon" information available for 1ZGS)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:442
 aligned with LEC_PARPC | P83304 from UniProtKB/Swiss-Prot  Length:447

    Alignment length:442
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442  
            LEC_PARPC     3 KGMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1zgsA01 A:3-149  [code=2.100.10.30, no name defined]                                                                                               1zgsA02 A:150-295  [code=2.100.10.30, no name defined]                                                                                            1zgsA03 A:296-444  [code=2.100.10.30, no name defined]                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee....hhhhh.eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee.....eee...ee.eeeeeeeeee...eeeeeeeeee.....eeeeeee.....eeeeee....eeeeeeee...eeeeeeee....eeeeee.........eeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eee...ee.eeeeeeeeee...eeeeeeeeee......eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee........eeeeee.......eeeeeeeeeeee...eeeeeeeeeeee...eeeeee....eee...ee.eeeeeeeeee.....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------R--------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --JACALIN_LECTIN  PDB: A:5-148 UniProt: 5-148                                                                                                     ----JACALIN_LECTIN  PDB: A:153-294 UniProt: 153-294                                                                                               -----JACALIN_LECTIN  PDB: A:300-443 UniProt: 300-443                                                                                                 - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zgs A   3 KGMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442

Chain B from PDB  Type:PROTEIN  Length:442
 aligned with LEC_PARPC | P83304 from UniProtKB/Swiss-Prot  Length:447

    Alignment length:442
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442  
            LEC_PARPC     3 KGMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1zgsB01 B:3-149  [code=2.100.10.30, no name defined]                                                                                               1zgsB02 B:150-295  [code=2.100.10.30, no name defined]                                                                                            1zgsB03 B:296-444  [code=2.100.10.30, no name defined]                                                                                                CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgsB01 B:311-443                                                                                                            - Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgsB02 B:311-443                                                                                                            - Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgsB03 B:311-443                                                                                                            - Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgsB04 B:311-443                                                                                                            - Pfam domains (4)
           Pfam domains (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgsB05 B:311-443                                                                                                            - Pfam domains (5)
           Pfam domains (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Jacalin-1zgsB06 B:311-443                                                                                                            - Pfam domains (6)
         Sec.struct. author ...eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee....hhhhh.eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee.....eee...ee.eeeeeeeeee.....eeeeeeee.....eeeeeee.....eeeeee....eeeeeeee...eeeeeeee....eeeeee........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eee...ee.eeeeeeeeee...eeeeeeeeee......eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee........eeeeee.......eeeeeeeeeeee...eeeeeeeeeeee...eeeeee....eee...ee.eeeeeeeeee.....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------R--------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --JACALIN_LECTIN  PDB: B:5-148 UniProt: 5-148                                                                                                     ----JACALIN_LECTIN  PDB: B:153-294 UniProt: 153-294                                                                                               -----JACALIN_LECTIN  PDB: B:300-443 UniProt: 300-443                                                                                                 - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zgs B   3 KGMISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISFKDASGDISGTFGGKDPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHGTISFGPWGGPAGDDAFNFKVGSWIKDIIIYADAAINSIAFKDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNYKGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKPRDVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 444
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1ZGS)

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Aligned Prism (39)

Topology: Vitelline Membrane Outer Layer Protein I, subunit A (39)

Homologous Superfamily: [code=2.100.10.30, no name defined] (33)

Parkia platycephala. Organism_taxid: 185447. (2)

1a	1zgsA01	A:3-149
1b	1zgsA03	A:296-444
1c	1zgsB03	B:296-444
1d	1zgsB01	B:3-149
1e	1zgsA02	A:150-295
1f	1zgsB02	B:150-295

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Jacalin] (35)

Family: Jacalin (35)

Parkia platycephala (2)

1a	Jacalin-1zgsB01	B:311-443
1b	Jacalin-1zgsB02	B:311-443
1c	Jacalin-1zgsB03	B:311-443
1d	Jacalin-1zgsB04	B:311-443
1e	Jacalin-1zgsB05	B:311-443
1f	Jacalin-1zgsB06	B:311-443

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (LEC_PARPC | P83304)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0005536	glucose binding	Interacting selectively and non-covalently with the D- or L-enantiomer of glucose.
	GO:0005537	mannose binding	Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.
biological process
	GO:0000771	agglutination involved in conjugation	The aggregation or adhesion of compatible mating types via complementary cell-cell interactions prior to the formation of irreversible cellular contacts during conjugation.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		XMM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:108 - Pro A:109	[ RasMol ]
		Gly A:157 - Pro A:158	[ RasMol ]
		Gly A:255 - Pro A:256	[ RasMol ]
		Gly A:304 - Pro A:305	[ RasMol ]
		Gly A:404 - Pro A:405	[ RasMol ]
		Gly A:9 - Pro A:10	[ RasMol ]
		Gly B:108 - Pro B:109	[ RasMol ]
		Gly B:157 - Pro B:158	[ RasMol ]
		Gly B:255 - Pro B:256	[ RasMol ]
		Gly B:304 - Pro B:305	[ RasMol ]
		Gly B:404 - Pro B:405	[ RasMol ]
		Gly B:9 - Pro B:10	[ RasMol ]
		Trp A:367 - Pro A:368	[ RasMol ]
		Trp A:74 - Pro A:75	[ RasMol ]
		Trp B:367 - Pro B:368	[ RasMol ]
		Trp B:74 - Pro B:75	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1zgs
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LEC_PARPC \| P83304
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LEC_PARPC \| P83304
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LEC_PARPC \| P83304	:	1zgr

1zgr	NATIVE PARKIA PLATYCEPHALA SEED LECTIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (16, 16)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 6)

PROSITE Motifs (1, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 6)

Pfam Domains (1, 6)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File