1YTY | PR0152 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURAL BASIS FOR RECOGNITION OF UUUOH 3'-TERMINII OF NASCENT RNA POL III TRANSCRIPTS BY LA AUTOANTIGEN

Authors :   M. Teplova, Y. R. Yuan, S. Ilin, L. Malinina, A. T. Phan, A. Teplov, D. J. P

Date :   11 Feb 05 (Deposition) - 17 Jan 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.29

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Protein-Rna Complex, Transcription-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Teplova, Y. R. Yuan, A. T. Phan, L. Malinina, S. Ilin, A. Teplov, D. J. Patel
Structural Basis For Recognition And Sequestration Of Uuu(Oh) 3' Temini Of Nascent Rna Polymerase Iii Transcripts By La, A Rheumatic Disease Autoantigen.
Mol. Cell V. 21 75 2006
PubMed-ID: 16387655 | Reference-DOI: 10.1016/J.MOLCEL.2005.10.027

*Molecule 1 - 5'-R(UPGPCPUPGPUPUPUPU)-3'**
	Chains	:	C, D
	Engineered	:	YES
	Synthetic	:	YES

Molecule 2 - LUPUS LA PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	MODIFIED PET28B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 1-194
	Gene	:	SSB
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SJOGREN SYNDROME TYPE B ANTIGEN, SS-B, LA RIBONUCLEOPROTEIN, LA AUTOANTIGEN

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 8)

No.	Name	Count	Type	Full Name
1	MSE	8	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	MSE	4	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 2 (1, 4)

No.	Name	Count	Type	Full Name
1	MSE	4	Mod. Amino Acid	SELENOMETHIONINE

(no "Site" information available for 1YTY)

(no "SS Bond" information available for 1YTY)

(no "Cis Peptide Bond" information available for 1YTY)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034066	P	48	S	LA_HUMAN	Polymorphism	17160793	A/B	P	48	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034066	P	48	S	LA_HUMAN	Polymorphism	17160793	A	P	48	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034066	P	48	S	LA_HUMAN	Polymorphism	17160793	B	P	48	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_LA	PS50961	La-type HTH domain profile.	LA_HUMAN	7-99	2	A:7-99 B:7-99
2	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	LA_HUMAN	111-187	2	A:111-187 B:111-187

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_LA	PS50961	La-type HTH domain profile.	LA_HUMAN	7-99	1	A:7-99 -
2	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	LA_HUMAN	111-187	1	A:111-187 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_LA	PS50961	La-type HTH domain profile.	LA_HUMAN	7-99	1	- B:7-99
2	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	LA_HUMAN	111-187	1	- B:111-187

Asymmetric Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000260956	2a	ENSE00001893329	chr2:170655322-170655486	165	LA_HUMAN	-	0	0	-	-
1.4	ENST00000260956	4	ENSE00002156069	chr2:170657462-170657536	75	LA_HUMAN	1-22	22	2	A:6-22 B:7-22	17 16
1.5	ENST00000260956	5	ENSE00001610086	chr2:170661984-170662087	104	LA_HUMAN	23-57	35	2	A:23-57 B:23-57	35 35
1.6a	ENST00000260956	6a	ENSE00000782038	chr2:170662175-170662349	175	LA_HUMAN	57-115	59	2	A:57-115 B:57-115	59 59
1.7c	ENST00000260956	7c	ENSE00000782039	chr2:170663295-170663402	108	LA_HUMAN	116-151	36	2	A:116-151 B:116-151	36 36
1.7g	ENST00000260956	7g	ENSE00002168098	chr2:170663481-170663581	101	LA_HUMAN	152-185	34	2	A:152-185 B:152-185	34 34
1.8c	ENST00000260956	8c	ENSE00000782041	chr2:170664992-170665063	72	LA_HUMAN	185-209	25	2	A:185-189 B:185-189	5 5
1.8e	ENST00000260956	8e	ENSE00000782042	chr2:170665370-170665412	43	LA_HUMAN	209-223	15	0	-	-
1.9c	ENST00000260956	9c	ENSE00000782043	chr2:170666793-170666933	141	LA_HUMAN	224-270	47	0	-	-
1.10b	ENST00000260956	10b	ENSE00000782044	chr2:170667368-170667554	187	LA_HUMAN	271-333	63	0	-	-
1.11	ENST00000260956	11	ENSE00000782045	chr2:170667693-170667833	141	LA_HUMAN	333-380	48	0	-	-
1.12b	ENST00000260956	12b	ENSE00001588653	chr2:170668178-170668574	397	LA_HUMAN	380-408	29	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:184
 aligned with LA_HUMAN | P05455 from UniProtKB/Swiss-Prot  Length:408

    Alignment length:184
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185    
             LA_HUMAN     6 DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF 189
               SCOP domains d1ytya1 A:6-103 Lupus La autoantigen N-terminal domain                                            d1ytya2 A:104-189 Lupus LA protein                                                     SCOP domains
               CATH domains 1ytyA01 A:6-90 'winged helix' repressor DNA binding domain                           ---------1ytyA02 A:100-189  [code=3.30.70.330, no name defined]                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh...eehhhhh.hhhhhhhh.hhhhhhhhhhh.....eee.....eeee.........hhhhhhhhhhheeeee......hhhhhhhhhhhhh.eeeeeeee.....eeeeeeeee.hhhhhhhhhhh...ee..ee.eeee.hhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -HTH_LA  PDB: A:7-99 UniProt: 7-99                                                            -----------RRM  PDB: A:111-187 UniProt: 111-187                                         -- PROSITE
           Transcript 1 (1) Exon 1.4         Exon 1.5  PDB: A:23-57             ----------------------------------------------------------Exon 1.7c  PDB: A:116-151           Exon 1.7g  PDB: A:152-185         ---- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.6a  PDB: A:57-115 UniProt: 57-115                   ---------------------------------------------------------------------1.8c  Transcript 1 (2)
                 1yty A   6 DNEKmAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEImIKFNRLNRLTTDFNVIVEALSKSKAELmEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQmRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF 189
                                |   15        25        35        45      | 55        65        75    |   85        95       105       115       125       135      |145       155       165       175       185    
                                |                                        52-MSE                      80-MSE                                                       142-MSE                                           
                               10-MSE

Chain B from PDB  Type:PROTEIN  Length:183
 aligned with LA_HUMAN | P05455 from UniProtKB/Swiss-Prot  Length:408

    Alignment length:183
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186   
             LA_HUMAN     7 NEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF 189
               SCOP domains d1ytyb1 B:7-103 Lupus La autoantigen N-terminal domain                                           d1ytyb2 B:104-189 Lupus LA protein                                                     SCOP domains
               CATH domains 1ytyB01 B:7-90 'winged helix' repressor DNA binding domain                          ---------1ytyB02 B:100-189  [code=3.30.70.330, no name defined]                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....eehhhhh.hhhhhhhh.hhhhhhhhhhh.....eee.....eeee.........hhhhhhhhhh.eeeee......hhhhhhhhhhhh..eeeeeeee.....eeeeeeeee.hhhhhhhhhhh...ee..ee.eeee.hhh. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE HTH_LA  PDB: B:7-99 UniProt: 7-99                                                            -----------RRM  PDB: B:111-187 UniProt: 111-187                                         -- PROSITE
           Transcript 1 (1) Exon 1.4        Exon 1.5  PDB: B:23-57             ----------------------------------------------------------Exon 1.7c  PDB: B:116-151           Exon 1.7g  PDB: B:152-185         ---- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.6a  PDB: B:57-115 UniProt: 57-115                   ---------------------------------------------------------------------1.8c  Transcript 1 (2)
                 1yty B   7 NEKmAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEImIKFNRLNRLTTDFNVIVEALSKSKAELmEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQmRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF 189
                               |    16        26        36        46     |  56        66        76   |    86        96       106       116       126       136     | 146       156       166       176       186   
                              10-MSE                                    52-MSE                      80-MSE                                                       142-MSE

Chain C from PDB  Type:RNA  Length:9
                                         
                 1yty C   1 UGCUGUUUU   9

Chain D from PDB  Type:RNA  Length:9
                                         
                 1yty D   1 UGCUGUUUU   9

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: DNA/RNA-binding 3-helical bundle (1299)

Superfamily: Winged helix DNA-binding domain (576)

Family: La domain (9)

Protein domain: Lupus La autoantigen N-terminal domain (8)

Human (Homo sapiens) [TaxId: 9606] (7)

1a	d1ytya1	A:6-103
1b	d1ytyb1	B:7-103

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: Canonical RBD (214)

Protein domain: Lupus LA protein (8)

Human (Homo sapiens) [TaxId: 9606] (8)

2a	d1ytya2	A:104-189
2b	d1ytyb2	B:104-189

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.330, no name defined] (307)

[unclassified] (45)

1a	1ytyA02	A:100-189
1b	1ytyB02	B:100-189

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Arc Repressor Mutant, subunit A (1030)

Homologous Superfamily: 'winged helix' repressor DNA binding domain (507)

[unclassified] (77)

2a	1ytyA01	A:6-90
2b	1ytyB01	B:7-90

(no "Pfam Domain" information available for 1YTY)

Asymmetric Unit(hide GO term definitions)

Chain A,B (LA_HUMAN | P05455)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
biological process
	GO:0075522	IRES-dependent viral translational initiation	Process by which viral mRNA translation is initiated, where a domain in the 5' untranslated region (UTR) of the viral mRNA called an internal ribosome entry site (IRES) binds the host 43S preinitiation complex, circumventing regular cap-dependent translation initiation.
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
	GO:0008334	histone mRNA metabolic process	The chemical reactions and pathways involving an mRNA encoding a histone.
	GO:1903608	protein localization to cytoplasmic stress granule	A process in which a protein is transported to, or maintained in, a location within a cytoplasmic stress granule.
	GO:0006400	tRNA modification	The covalent alteration of one or more nucleotides within a tRNA molecule to produce a tRNA molecule with a sequence that differs from that coded genetically.
cellular component
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1yty)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yty)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1yty
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LA_HUMAN \| P05455
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LA_HUMAN \| P05455
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LA_HUMAN \| P05455	:	1owx 1s79 1s7a 1zh5 2vod 2von 2voo 2vop

(no "Related Entries Specified in the PDB File" available for 1YTY)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 8)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (2, 4)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File