1X5D - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   THE SOLUTION STRUCTURE OF THE SECOND THIOREDOXIN-LIKE DOMAIN OF HUMAN PROTEIN DISULFIDE-ISOMERASE A6

Authors :   N. Tochio, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   15 May 05 (Deposition) - 15 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Pdia6, Erp5, P5, Txndc7, Thioredoxin Like Domain, Redox, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. Tochio, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - PROTEIN DISULFIDE-ISOMERASE A6
	Chains	:	A
	EC Number	:	5.3.4.1
	Engineered	:	YES
	Expression System Plasmid	:	P040628-10
	Expression System Vector Type	:	PLASMID
	Fragment	:	THIOREDOXIN LIKE DOMAIN
	Gene	:	PDIA6
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	PROTEIN DISULFIDE ISOMERASE P5, THIOREDOXIN DOMAIN CONTAINING PROTEIN 7


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1X5D)

(no "Site" information available for 1X5D)

(no "SS Bond" information available for 1X5D)

NMR Structure

No.	Model	Residues
1	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20	Phe A:84	-	Pro A:85

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_022152	K	214	R	PDIA6_HUMAN	Polymorphism	4807	A	K	61	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	THIOREDOXIN_2	PS51352	Thioredoxin domain profile.	PDIA6_HUMAN	2-133 154-287	1	- A:8-127
2	THIOREDOXIN_1	PS00194	Thioredoxin family active site.	PDIA6_HUMAN	47-65 182-200	1	- A:29-47

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.8a	ENST00000272227	8a	ENSE00001401250	chr2:10952970-10952804	167	PDIA6_HUMAN	1-7	7	0	-	-
1.10	ENST00000272227	10	ENSE00000996575	chr2:10942766-10942625	142	PDIA6_HUMAN	7-54	48	0	-	-
1.11	ENST00000272227	11	ENSE00000962411	chr2:10937883-10937826	58	PDIA6_HUMAN	54-73	20	0	-	-
1.12b	ENST00000272227	12b	ENSE00000962412	chr2:10937333-10937207	127	PDIA6_HUMAN	74-116	43	0	-	-
1.13	ENST00000272227	13	ENSE00000962413	chr2:10933328-10933222	107	PDIA6_HUMAN	116-151	36	1	A:1-7 (gaps)	9
1.14	ENST00000272227	14	ENSE00000962414	chr2:10932051-10931921	131	PDIA6_HUMAN	152-195	44	1	A:8-42	35
1.15	ENST00000272227	15	ENSE00000962415	chr2:10930959-10930845	115	PDIA6_HUMAN	195-233	39	1	A:42-80	39
1.16	ENST00000272227	16	ENSE00000962416	chr2:10930015-10929875	141	PDIA6_HUMAN	234-280	47	1	A:81-127	47
1.17	ENST00000272227	17	ENSE00000962418	chr2:10929107-10929023	85	PDIA6_HUMAN	281-309	29	1	A:128-129	2
1.18	ENST00000272227	18	ENSE00000962419	chr2:10928895-10928823	73	PDIA6_HUMAN	309-333	25	1	A:129-133	5
1.19	ENST00000272227	19	ENSE00000962420	chr2:10927565-10927407	159	PDIA6_HUMAN	333-386	54	0	-	-
1.20	ENST00000272227	20	ENSE00000962421	chr2:10925156-10925060	97	PDIA6_HUMAN	386-418	33	0	-	-
1.21c	ENST00000272227	21c	ENSE00001893291	chr2:10924452-10923517	936	PDIA6_HUMAN	419-440	22	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:133
 aligned with PDIA6_HUMAN | Q15084 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:173
                                   150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310   
          PDIA6_HUMAN   141 GRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGR 313
               SCOP domains d1x5  da_            A: automated matches                                                                                                                                     SCOP domains
               CATH domains 1x5d  A01            A:1-120 Glutaredoxin                                                                                            ---------------------------------------- CATH domains
               Pfam domains --------------------Thioredoxin-1x5dA01 A:8-114                                                                                ---------------------------------------------- Pfam domains
         Sec.struct. author ....--...-----------..ee...hhhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhhhhhh...eeeeeee....hhhhhhhh.....eeeeee..eeeeee....hhhhhhhhhhhhhhhhh.......---------------------------.hhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------R--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------THIOREDOXIN_2  PDB: A:8-127 UniProt: 154-287                                                                                          -------------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------THIOREDOXIN_1      ----------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.13  Exon 1.14  PDB: A:8-42 UniProt: 152-195     --------------------------------------Exon 1.16  PDB: A:81-127 UniProt: 234-280      Exon 1.17  PDB: A:128-129    ---- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.15  PDB: A:42-80                ---------------------------------------------------------------------------1.18  Transcript 1 (2)
                 1x5d A   1 GSSG--SSG-----------DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLE---------------------------SGPSSG 133
                               |  | |-         -|       17        27        37        47        57        67        77        87        97       107       117       127         -         -       130   
                               4  5 7           8                                                                                                                    127                         128

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: automated matches (347)

Protein domain: automated matches (347)

Human (Homo sapiens) [TaxId: 9606] (87)

d1x5da_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

1x5dA01

A:1-120

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Thioredoxin (367)

Family: Thioredoxin (82)

Homo sapiens (Human) (20)

Thioredoxin-1x5dA01

A:8-114

NMR Structure(hide GO term definitions)

Chain A (PDIA6_HUMAN | Q15084)

molecular function
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003756	protein disulfide isomerase activity	Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
biological process
	GO:0036498	IRE1-mediated unfolded protein response	A series of molecular signals mediated by the endoplasmic reticulum stress sensor IRE1 (Inositol-requiring transmembrane kinase/endonuclease). Begins with activation of IRE1 in response to endoplasmic reticulum (ER) stress, and ends with regulation of a downstream cellular process, e.g. transcription. One target of activated IRE1 is the transcription factor HAC1 in yeast, or XBP1 in mammals; IRE1 cleaves an intron of a mRNA coding for HAC1/XBP1 to generate an activated HAC1/XBP1 transcription factor, which controls the up regulation of UPR-related genes. At least in mammals, IRE1 can also signal through additional intracellular pathways including JNK and NF-kappaB.
	GO:0043277	apoptotic cell clearance	The recognition and removal of an apoptotic cell by a neighboring cell or by a phagocyte.
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0034663	endoplasmic reticulum chaperone complex	A protein complex that is located in the endoplasmic reticulum and is composed of chaperone proteins, including BiP, GRP94; CaBP1, protein disulfide isomerase (PDI), ERdj3, cyclophilin B, ERp72, GRP170, UDP-glucosyltransferase, and SDF2-L1.
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	A complex system of membrane-bounded compartments located between endoplasmic reticulum (ER) and the Golgi complex, with a distinctive membrane protein composition; involved in ER-to-Golgi and Golgi-to-ER transport.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x5d)

	Sites
(no "Sites" information available for 1x5d)

	Cis Peptide Bonds
		Phe A:84 - Pro A:85	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1x5d
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDIA6_HUMAN \| Q15084
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	5.3.4.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDIA6_HUMAN \| Q15084
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PDIA6_HUMAN \| Q15084	:	3vww 3w8j 4ef0 4gwr

(no "Related Entries Specified in the PDB File" available for 1X5D)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 20)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (2, 2)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File