![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 100) |
(no "Site" information available for 1WQ2) |
(no "SS Bond" information available for 1WQ2) |
(no "Cis Peptide Bond" information available for 1WQ2) |
(no "SAP(SNP)/Variant" information available for 1WQ2) |
(no "PROSITE Motif" information available for 1WQ2) |
(no "Exon" information available for 1WQ2) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:65 aligned with DSVD_DESVH | Q46582 from UniProtKB/Swiss-Prot Length:78 Alignment length:70 10 20 30 40 50 60 70 DSVD_DESVH 1 MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGK 70 SCOP domains d1wq2a_ A: aut omated matches SCOP domains CATH domains 1wq2A00 A:1-70 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 1wq2 A 1 MEEAKQKVVDFLNS-----SKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGK 70 10 | 20 30 40 50 60 70 14 20 Chain B from PDB Type:PROTEIN Length:66 aligned with DSVD_DESVH | Q46582 from UniProtKB/Swiss-Prot Length:78 Alignment length:68 10 20 30 40 50 60 DSVD_DESVH 1 MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGA 68 SCOP domains d1wq2b_ B: auto mated matches SCOP domains CATH domains 1wq2B00 B:1-68 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --DsrD-1wq2B01 B:3-68 Pfam domains (1) Pfam domains (2) --DsrD-1wq2B02 B:3-68 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 1wq2 B 1 MEEAKQKVVDFLNSK--SKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGA 68 10 | |20 30 40 50 60 15 18
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1WQ2)
|
|
|
|
|
|
|