|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 5)
|
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 1UCR) |
(no "Cis Peptide Bond" information available for 1UCR) |
(no "SAP(SNP)/Variant" information available for 1UCR) |
(no "PROSITE Motif" information available for 1UCR) |
(no "Exon" information available for 1UCR) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:74 aligned with DSVD_DESVH | Q46582 from UniProtKB/Swiss-Prot Length:78 Alignment length:74 10 20 30 40 50 60 70 DSVD_DESVH 1 MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA 74 SCOP domains d1ucra_ A: Dissimilatory sulfite reductase DsvD SCOP domains CATH domains 1ucrA00 A:1-74 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 1ucr A 1 MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA 74 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:75 aligned with DSVD_DESVH | Q46582 from UniProtKB/Swiss-Prot Length:78 Alignment length:75 10 20 30 40 50 60 70 DSVD_DESVH 1 MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAAE 75 SCOP domains d1ucrb_ B: Dissimilatory sulfite reductase DsvD SCOP domains CATH domains 1ucrB00 B:1-75 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --DsrD-1ucrB01 B:3-69 ------ Pfam domains (1) Pfam domains (2) --DsrD-1ucrB02 B:3-69 ------ Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------- Transcript 1ucr B 1 MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAAE 75 10 20 30 40 50 60 70
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1UCR)
|
|
|
|
|
|
|