1WJQ - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE THIRD MBT DOMAIN FROM HUMAN KIAA1798 PROTEIN

Authors :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   29 May 04 (Deposition) - 29 Nov 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Mbt Domain, Kiaa1798, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Third Mbt Domain From Human Kiaa1798 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - KIAA1798 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040119-32
	Expression System Vector Type	:	PLASMID
	Fragment	:	MBT DOMAIN
	Gene	:	KAZUSA CDNA FJ20547
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1WJQ)

Sites (0, 0)

(no "Site" information available for 1WJQ)

SS Bonds (0, 0)

(no "SS Bond" information available for 1WJQ)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1WJQ)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 1WJQ)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ZF_CCHHC	PS51802	Zinc finger CCHHC-type profile.	LMBL3_HUMAN	549-593	1	A:88-106

Exons (5, 5)

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.5c	ENST00000368136	5c	ENSE00002182355	chr6:130341702-130341813	112	LMBL3_HUMAN	-	0	0	-	-
1.6	ENST00000368136	6	ENSE00001409294	chr6:130343372-130343450	79	LMBL3_HUMAN	-	0	0	-	-
1.7	ENST00000368136	7	ENSE00001411632	chr6:130363830-130363946	117	LMBL3_HUMAN	1-34	34	0	-	-
1.8	ENST00000368136	8	ENSE00000975595	chr6:130370427-130370538	112	LMBL3_HUMAN	35-72	38	0	-	-
1.9b	ENST00000368136	9b	ENSE00001084666	chr6:130370901-130370975	75	LMBL3_HUMAN	72-97	26	0	-	-
1.10b	ENST00000368136	10b	ENSE00000975596	chr6:130372394-130372553	160	LMBL3_HUMAN	97-150	54	0	-	-
1.11b	ENST00000368136	11b	ENSE00000975597	chr6:130374004-130374136	133	LMBL3_HUMAN	150-194	45	0	-	-
1.12b	ENST00000368136	12b	ENSE00000975598	chr6:130376316-130376400	85	LMBL3_HUMAN	195-223	29	0	-	-
1.13	ENST00000368136	13	ENSE00002162936	chr6:130378551-130378642	92	LMBL3_HUMAN	223-253	31	0	-	-
1.14	ENST00000368136	14	ENSE00002186523	chr6:130381181-130381285	105	LMBL3_HUMAN	254-288	35	0	-	-
1.15	ENST00000368136	15	ENSE00002186040	chr6:130387498-130387633	136	LMBL3_HUMAN	289-334	46	0	-	-
1.16b	ENST00000368136	16b	ENSE00000975602	chr6:130389475-130389566	92	LMBL3_HUMAN	334-364	31	0	-	-
1.17b	ENST00000368136	17b	ENSE00000975603	chr6:130392121-130392272	152	LMBL3_HUMAN	365-415	51	0	-	-
1.18	ENST00000368136	18	ENSE00002154851	chr6:130399703-130399779	77	LMBL3_HUMAN	415-441	27	0	-	-
1.19	ENST00000368136	19	ENSE00002160966	chr6:130404765-130404850	86	LMBL3_HUMAN	441-469	29	1	A:1-8	8
1.20	ENST00000368136	20	ENSE00002177917	chr6:130407285-130407395	111	LMBL3_HUMAN	470-506	37	1	A:9-45	37
1.21b	ENST00000368136	21b	ENSE00000975607	chr6:130413890-130414004	115	LMBL3_HUMAN	507-545	39	1	A:46-84	39
1.22	ENST00000368136	22	ENSE00000975608	chr6:130415410-130415512	103	LMBL3_HUMAN	545-579	35	1	A:84-106 (gaps)	35
1.23	ENST00000368136	23	ENSE00000975609	chr6:130425571-130425720	150	LMBL3_HUMAN	579-629	51	1	A:106-107	2
1.24	ENST00000368136	24	ENSE00000975610	chr6:130442024-130442103	80	LMBL3_HUMAN	629-656	28	0	-	-
1.25	ENST00000368136	25	ENSE00000975611	chr6:130454597-130454766	170	LMBL3_HUMAN	656-712	57	0	-	-
1.26	ENST00000368136	26	ENSE00000975612	chr6:130454988-130455050	63	LMBL3_HUMAN	713-733	21	0	-	-
1.27d	ENST00000368136	27d	ENSE00002176826	chr6:130460755-130462584	1830	LMBL3_HUMAN	734-780	47	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:107
 aligned with LMBL3_HUMAN | Q96JM7 from UniProtKB/Swiss-Prot  Length:780

    Alignment length:119
                                   471       481       491       501       511       521       531       541       551       561       571         
          LMBL3_HUMAN   462 APARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCSTPGCKGIGHFKRARHLGPHSA 580
               SCOP domains d1wjqa_ A: Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798)                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------MBT-1wjqA01 A:18-87                                                   -------------------------------- Pfam domains
         Sec.struct. author ..................eeeee.......eeeeee.......eeee....hhhhheee.......ee.hhhhhhh..........................------------..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------ZF_CCHHC  PDB: A:88-106          PROSITE
           Transcript 1 (1) 1.19    Exon 1.20  PDB: A:9-45               Exon 1.21b  PDB: A:46-84               ---------------------------------1. Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------Exon 1.22  PDB: A:84-106 (gaps)    - Transcript 1 (2)
                 1wjq A   1 GSSGSSGVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCSTPGS------------GPSSG 107
                                    10        20        30        40        50        60        70        80        90       100 |       -    |    
                                                                                                                               102          103

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: Tudor/PWWP/MBT (72)

Family: MBT repeat (8)

Protein domain: Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) (2)

Human (Homo sapiens) [TaxId: 9606] (2)

d1wjqa_

CATH Domains (0, 0)

(no "CATH Domain" information available for 1WJQ)

Pfam Domains (1, 1)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Tudor (88)

Family: MBT (24)

Homo sapiens (Human) (20)

MBT-1wjqA01

A:18-87

Gene Ontology (9, 9)

NMR Structure(hide GO term definitions)

Chain A (LMBL3_HUMAN | Q96JM7)

molecular function
	GO:0003674	molecular_function	Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0043249	erythrocyte maturation	A developmental process, independent of morphogenetic (shape) change, that is required for an erythrocyte to attain its fully functional state.
	GO:0030851	granulocyte differentiation	The process in which a myeloid precursor cell acquires the specialized features of a granulocyte. Granulocytes are a class of leukocytes characterized by the presence of granules in their cytoplasm. These cells are active in allergic immune reactions such as arthritic inflammation and rashes. This class includes basophils, eosinophils and neutrophils.
	GO:0030225	macrophage differentiation	The process in which a relatively unspecialized monocyte acquires the specialized features of a macrophage.
	GO:0030099	myeloid cell differentiation	The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1wjq)

	Sites
(no "Sites" information available for 1wjq)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wjq)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1wjq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LMBL3_HUMAN \| Q96JM7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LMBL3_HUMAN \| Q96JM7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	LMBL3_HUMAN \| Q96JM7	:	1wjs 3ut1 4fl6 4l59

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WJQ)