Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE 3-MBT REPEAT DOMAIN OF L3MBTL3 AND UNC2533 COMPLEX
 
Authors :  N. Zhong, A. Dong, M. Ravichandran, M. A. Camerino, B. M. Dickson, L. I. J B. M. Baughman, J. L. Norris, D. B. Kireev, W. P. Janzen, S. Graslund, S. C. Bountra, A. M. Edwards, C. H. Arrowsmith, P. J. Brown, Structural G Consortium (Sgc)
Date :  10 Jun 13  (Deposition) - 10 Jul 13  (Release) - 25 Dec 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.29
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  3-Mbt Repeat Domain, L3Mbtl3, Unc2533, Structural Genomics, Structural Genomics Consortium, Sgc, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Zhong, A. Dong, M. Ravichandran, M. A. Camerino, B. M. Dickson, L. I. James, B. M. Baughman, J. L. Norris, D. B. Kireev, W. P. Janzen, S. Graslund, S. V. Frye, C. Bountra, A. M. Edwards, C. H. Arrowsmith, P. J. Brown
Crystal Structure Of The 3-Mbt Repeat Domain Of L3Mbtl3 And Unc2533 Complex
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LETHAL(3)MALIGNANT BRAIN TUMOR-LIKE PROTEIN 3
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28-MHL
    Expression System StrainBL21-V2R-PRARE2
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneL3MBTL3, KIAA1798, MBT1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymH-L(3)MBT-LIKE PROTEIN 3, L(3)MBT-LIKE PROTEIN 3, MBT-1

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric Unit (3, 14)
No.NameCountTypeFull Name
11VZ1Ligand/Ion4-(PYRROLIDIN-1-YL)-1-{4-[2-(PYRROLIDIN-1-YL)ETHYL]PHENYL}PIPERIDINE
2SO41Ligand/IonSULFATE ION
3UNX12Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 1 (3, 28)
No.NameCountTypeFull Name
11VZ2Ligand/Ion4-(PYRROLIDIN-1-YL)-1-{4-[2-(PYRROLIDIN-1-YL)ETHYL]PHENYL}PIPERIDINE
2SO42Ligand/IonSULFATE ION
3UNX24Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:274 , HIS A:277 , PHE A:298 , TYR A:305 , ASP A:381 , PHE A:387 , CYS A:389 , PHE A:405 , TRP A:408 , TYR A:412BINDING SITE FOR RESIDUE 1VZ A 601
2AC2SOFTWAREHIS A:508 , ASP A:510 , GLY A:511BINDING SITE FOR RESIDUE SO4 A 602

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4L59)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4L59)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4L59)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4L59)

(-) Exons   (0, 0)

(no "Exon" information available for 4L59)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:307
                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains d4l59a1 A:232-339 automated matches                                                                         d4l59a2 A:340-447 automated matches                                                                   d4l59a3 A:448-544 automated matches                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.....hhhhh.................eeeeee..eeeeeeeeeeeeee..eeeeee...hhhhheeee.....ee..hhhhhhh..ee.....hhhhhhhhhhhhhhh....hhhhh...........eeeee.......eeeeeeeeee..eeeeee...hhhhheee......ee..hhhhhh...ee.....hhhhhhhhhhhhhh.....hhhhh............eeeee.......eeeeeeeee...eeeeee...hhhhheeee.....ee..hhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4l59 A 232 WCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL 544
                                   241       251       261       271       281       291       301       311       321       331       341       351       366       376       386       396       406       416       426       436     ||447       457       467       477       487       497       507       517       527       537       
                                                                                                                                                          360|                                                                         442|                                                                                                    
                                                                                                                                                           366                                                                          444                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4L59)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4L59)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1VZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4l59)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4l59
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LMBL3_HUMAN | Q96JM7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LMBL3_HUMAN | Q96JM7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LMBL3_HUMAN | Q96JM71wjq 1wjs 3ut1 4fl6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4L59)