1UJY - JenaLib

Title :   SOLUTION STRUCTURE OF SH3 DOMAIN IN RAC/CDC42 GUANINE NUCLEOTIDE EXCHANGE FACTOR(GEF) 6

Authors :   F. He, Y. Muto, H. Uda, S. Koshiba, M. Shirouzu, T. Terada, T. Kigawa, M. Inoue, T. Yabuki, M. Aoki, E. Seki, T. Matsuda, H. Hirota, M. Yoshida N. Kobayashi, A. Tanaka, T. Osanai, Y. Matsuo, O. Ohara, T. Nagase, R. Kikuno, M. Nagayama, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   12 Aug 03 (Deposition) - 12 Feb 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Nmr, Structural Genomics, Sh3 Domain, Gef 6, Riken Structural Genomics/Proteomics Initiative, Rsgi, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. He, Y. Muto, H. Uda, S. Koshiba, M. Shirouzu, T. Terada, T. Kigawa, M. Inoue, T. Yabuki, M. Aoki, E. Seki, T. Matsuda, H. Hirota, M. Yoshida, N. Kobayashi, A. Tanaka, T. Osanai, Y. Matsuo, O. Ohara, T. Nagase, R. Kikuno, M. Nagayama, S. Yokoyama
Solution Structure Of Sh3 Domain In Rac/Cdc42 Guanine Nucleotide Exchange Factor(Gef) 6
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (3, 3)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000250617	1	ENSE00000979461	X:135864247-135862877	1371	ARHG6_HUMAN	1-55	55	0	-	-
1.2	ENST00000250617	2	ENSE00000979462	X:135861656-135861573	84	ARHG6_HUMAN	56-83	28	0	-	-
1.5	ENST00000250617	5	ENSE00001750147	X:135829751-135829667	85	ARHG6_HUMAN	84-112	29	0	-	-
1.6	ENST00000250617	6	ENSE00001611860	X:135827506-135827382	125	ARHG6_HUMAN	112-153	42	1	A:1-6	6
1.7	ENST00000250617	7	ENSE00001771122	X:135825945-135825744	202	ARHG6_HUMAN	154-221	68	1	A:7-69	63
1.8	ENST00000250617	8	ENSE00000890637	X:135814331-135814261	71	ARHG6_HUMAN	221-244	24	1	A:69-76 (gaps)	19
1.9	ENST00000250617	9	ENSE00000890636	X:135795529-135795435	95	ARHG6_HUMAN	245-276	32	0	-	-
1.10	ENST00000250617	10	ENSE00000677037	X:135790929-135790834	96	ARHG6_HUMAN	276-308	33	0	-	-
1.11	ENST00000250617	11	ENSE00000890635	X:135789189-135789067	123	ARHG6_HUMAN	308-349	42	0	-	-
1.12	ENST00000250617	12	ENSE00000890634	X:135772907-135772769	139	ARHG6_HUMAN	349-395	47	0	-	-
1.13	ENST00000250617	13	ENSE00000890633	X:135770150-135770091	60	ARHG6_HUMAN	396-415	20	0	-	-
1.14	ENST00000250617	14	ENSE00000890632	X:135767982-135767836	147	ARHG6_HUMAN	416-464	49	0	-	-
1.15	ENST00000250617	15	ENSE00001617240	X:135765003-135764917	87	ARHG6_HUMAN	465-493	29	0	-	-
1.16	ENST00000250617	16	ENSE00000890630	X:135764127-135764049	79	ARHG6_HUMAN	494-520	27	0	-	-
1.17	ENST00000250617	17	ENSE00001246193	X:135763035-135762890	146	ARHG6_HUMAN	520-568	49	0	-	-
1.18	ENST00000250617	18	ENSE00000890628	X:135761819-135761694	126	ARHG6_HUMAN	569-610	42	0	-	-
1.19	ENST00000250617	19	ENSE00001436514	X:135760115-135760095	21	ARHG6_HUMAN	611-617	7	0	-	-
1.20	ENST00000250617	20	ENSE00001436482	X:135758876-135758783	94	ARHG6_HUMAN	618-649	32	0	-	-
1.21	ENST00000250617	21	ENSE00000890626	X:135757255-135757166	90	ARHG6_HUMAN	649-679	31	0	-	-
1.22	ENST00000250617	22	ENSE00000677022	X:135754278-135754179	100	ARHG6_HUMAN	679-712	34	0	-	-
1.23	ENST00000250617	23	ENSE00000677021	X:135751695-135751641	55	ARHG6_HUMAN	712-730	19	0	-	-
1.24	ENST00000250617	24	ENSE00001453176	X:135750328-135747706	2623	ARHG6_HUMAN	731-776	46	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:76
 aligned with ARHG6_HUMAN | Q15052 from UniProtKB/Swiss-Prot  Length:776

    Alignment length:103
                                   146       156       166       176       186       196       206       216       226       236   
          ARHG6_HUMAN   137 GAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTK 239
               SCOP domains d1ujya                _ A: Rac/CDC42 GEF 6                                                              SCOP domains
               CATH domains 1ujyA0                0 A:1-76 SH3 Domains                                                              CATH domains
               Pfam domains ---------------------------SH3_2-1ujyA01 A:12-65                                 ---------------------- Pfam domains
         Sec.struct. author ......----------------....eeee....................eee........eeeee..eeeee.....ee..hhhh-----------...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------SH3  PDB: A:8-67 UniProt: 160-219                           -------------------- PROSITE
           Transcript 1 (1) Exon 1.6         Exon 1.7  PDB: A:7-69 UniProt: 154-221 [INCOMPLETE]                 ------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------Exon 1.8            Transcript 1 (2)
                 1ujy A   1 GSSGSS----------------GSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSER-----------SGPSSG  76
                                 |   -         -  |     14        24        34        44        54        64     |   -       |73   
                                 6                7                                                             70          71

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (15, 15)

NMR Structure(hide GO term definitions)

Chain A (ARHG6_HUMAN | Q15052)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005089	Rho guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005085	guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007254	JNK cascade	An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0030032	lamellipodium assembly	Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ujy)

	Sites
(no "Sites" information available for 1ujy)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ujy)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ujy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARHG6_HUMAN \| Q15052
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description