Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SH3 DOMAIN OF HYPOTHETICAL PROTEIN BAA76854.1
 
Authors :  T. Nagata, Y. Muto, Y. Kamewari, M. Shirouzu, T. Terada, T. Kigawa, M. Inoue, T. Yabuki, M. Aoki, E. Seki, T. Matsuda, H. Hirota, M. Yoshida N. Kobayashi, A. Tanaka, T. Osanai, Y. Matsuo, O. Ohara, T. Nagase, R. Kikuno, M. Nakayama, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  11 Jun 03  (Deposition) - 11 Dec 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Sh3 Domain, Hypothetical Protein Baa76854. 1, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Nagata, Y. Muto, Y. Kamewari, M. Shirouzu, T. Terada, T. Kigawa, M. Inoue, T. Yabuki, M. Aoki, E. Seki, T. Matsuda, H. Hirota, M. Yoshida, N. Kobayashi, A. Tanaka, T. Osanai, Y. Matsuo, O. Ohara, T. Nagase, R. Kikuno, M. Nakayama, S. Yokoyama
Nmr Structure Of Sh3 Domain Of Hypothetical Protein Baa76854. 1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KIAA1010 PROTEIN
    Chains: A
    Engineered: YES
    Expression System Plasmid: P021015-49
    Expression System Vector Type: PLASMID
    Fragment: SH3 DOMAIN
    Gene: KAZUSA CDNA HJ05262
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: CELL-FREE PROTEIN SYNTHESIS
    Synonym: HYPOTHETICAL PROTEIN BAA76854.1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UG1)

(-) Sites  (0, 0)

(no "Site" information available for 1UG1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UG1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UG1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UG1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UG1)

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003241091ENSE00001424407chr10:101769676-10176959582DNMBP_HUMAN-00--
1.2ENST000003241092ENSE00002142171chr10:101731891-101731737155DNMBP_HUMAN1-49490--
1.3ENST000003241093ENSE00001706506chr10:101728994-101728872123DNMBP_HUMAN49-90420--
1.4ENST000003241094ENSE00001719112chr10:101716962-1017149711992DNMBP_HUMAN90-7546650--
1.6ENST000003241096ENSE00001756411chr10:101668903-101668710194DNMBP_HUMAN754-818650--
1.7ENST000003241097ENSE00001121904chr10:101667851-101667752100DNMBP_HUMAN819-852340--
1.8ENST000003241098ENSE00001121895chr10:101659823-101659676148DNMBP_HUMAN852-901500--
1.10ENST0000032410910ENSE00001805771chr10:101658517-10165850018DNMBP_HUMAN901-90770--
1.12bENST0000032410912bENSE00002155272chr10:101658042-101657843200DNMBP_HUMAN907-974680--
1.13bENST0000032410913bENSE00001668127chr10:101656154-101656024131DNMBP_HUMAN974-1017440--
1.14ENST0000032410914ENSE00001784342chr10:101654807-101654703105DNMBP_HUMAN1018-1052350--
1.15bENST0000032410915bENSE00001699707chr10:101648710-101648582129DNMBP_HUMAN1053-1095430--
1.16bENST0000032410916bENSE00001760747chr10:101646389-101646057333DNMBP_HUMAN1096-12061110--
1.17ENST0000032410917ENSE00001671273chr10:101645623-101645444180DNMBP_HUMAN1207-1266601A:1-7 (gaps)48
1.18ENST0000032410918ENSE00001705620chr10:101643966-101643768199DNMBP_HUMAN1267-1333671A:8-6356
1.19ENST0000032410919ENSE00001624505chr10:101640118-101639568551DNMBP_HUMAN1333-15161841A:63-92 (gaps)65
1.20ENST0000032410920ENSE00001621278chr10:101637093-1016353341760DNMBP_HUMAN1517-1577610--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:92
 aligned with DNMBP_HUMAN | Q6XZF7 from UniProtKB/Swiss-Prot  Length:1577

    Alignment length:186
                                  1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      
         DNMBP_HUMAN   1212 GREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSG 1397
               SCOP domains d1ug                                         1a_                   A: Hypothetical protein Baa76854.1 (KIAA1010)                                                                           SCOP domains
               CATH domains 1ug1                                         A00                   A:1-92 SH3 Domains                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhh-----------------------------------------hhh------------------hhhhhhhhhh.eeee..................eeeeee.........eeeee....eeeee...eee.............----------------------------..-------.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.17  PDB: A:1-7 (gaps) UniProt: 1207-1266        Exon 1.18  PDB: A:8-63 UniProt: 1267-1333 [INCOMPLETE]             ---------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------Exon 1.19  PDB: A:63-92 (gaps) UniProt: 1333-1516 [INCOMPLETE]    Transcript 1 (2)
                1ug1 A    1 GSSG-----------------------------------------SSG------------------ASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASSG----------------------------PS-------SG   92
                               |     -         -         -         -     | | -         -      | 11        21        31        41        51        61        71        81      |  -         -         -     ||  -    | 
                               4                                         5 7                  8                                                                              88                           89|      91 
                                                                                                                                                                                                           90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1UG1)

(-) Gene Ontology  (12, 12)

NMR Structure(hide GO term definitions)
Chain A   (DNMBP_HUMAN | Q6XZF7)
molecular function
    GO:0005089    Rho guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0005085    guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0035023    regulation of Rho protein signal transduction    Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005795    Golgi stack    The set of thin, flattened membrane-bounded compartments, called cisternae, that form the central portion of the Golgi complex. The stack usually comprises cis, medial, and trans cisternae; the cis- and trans-Golgi networks are not considered part of the stack.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ug1)
 
  Sites
(no "Sites" information available for 1ug1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ug1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ug1
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DNMBP_HUMAN | Q6XZF7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DNMBP_HUMAN | Q6XZF7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DNMBP_HUMAN | Q6XZF7: 1uhc 4cc2 4cc3 4cc4 4cc7 4glm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UG1)