1T9G - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF THE HUMAN MCAD:ETF COMPLEX

Authors :   H. S. Toogood, A. Van Thiel, J. Basran, M. J. Sutcliffe, N. S. Scrutton, D. Leys

Date :   17 May 04 (Deposition) - 08 Jun 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym./Biol. Unit : A,B,C,D,R,S

Keywords :   Electron Transfer, Protein:Protein Complex, Fatty Acid Oxidation, Human Electron Transferring Flavoprotein, Human Medium Chain Acyl Coa Dehydrogenase, Oxidoreductase, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. S. Toogood, A. Van Thiel, J. Basran, M. J. Sutcliffe, N. S. Scrutton, D. Leys
Extensive Domain Motion And Electron Transfer In The Human Electron Transferring Flavoprotein-Medium Chain Acyl-Coa Dehydrogenase Complex
J. Biol. Chem. V. 279 32904 2004
PubMed-ID: 15159392 | Reference-DOI: 10.1074/JBC.M404884200
(for further references see the PDB file header)

Molecule 1 - ACYL-COA DEHYDROGENASE, MEDIUM-CHAIN SPECIFIC, MITOCHONDRIAL
	Chains	:	A, B, C, D
	EC Number	:	1.3.99.3
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	ACADM
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MCAD

Molecule 2 - ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT, MITOCHONDRIAL
	Chains	:	R
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	ETFA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ALPHA-ETF

Molecule 3 - ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
	Chains	:	S
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	ETFB
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	BETA-ETF

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	R	S

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 5)

No.	Name	Count	Type	Full Name
1	AMP	1	Ligand/Ion	ADENOSINE MONOPHOSPHATE
2	FAD	4	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA S:9 , VAL S:10 , LYS S:11 , CYS S:42 , CYS S:66 , LEU S:122 , GLY S:123 , GLN S:125 , ALA S:126 , ASP S:129 , CYS S:131 , ASN S:132 , GLN S:133 , THR S:134	BINDING SITE FOR RESIDUE AMP S 600
2	AC2	SOFTWARE	TYR A:133 , CYS A:134 , VAL A:135 , THR A:136 , GLY A:141 , SER A:142 , TRP A:166 , ILE A:167 , THR A:168 , ILE A:371 , ILE A:374 , TYR A:375 , GLU A:376 , THR A:378 , GLN A:380 , ARG B:281 , THR B:283 , PHE B:284 , HIS B:291 , GLN B:349 , ILE B:350 , GLY B:353 , GLN D:292	BINDING SITE FOR RESIDUE FAD A 399
3	AC3	SOFTWARE	ARG A:281 , THR A:283 , PHE A:284 , LEU A:288 , HIS A:291 , GLN A:349 , ILE A:350 , GLY A:353 , TYR B:133 , VAL B:135 , THR B:136 , GLY B:141 , SER B:142 , TRP B:166 , ILE B:167 , THR B:168 , ASN B:214 , THR B:222 , ILE B:374 , TYR B:375 , THR B:378 , GLN B:380 , GLN C:292	BINDING SITE FOR RESIDUE FAD B 399
4	AC4	SOFTWARE	GLN B:292 , TYR C:133 , VAL C:135 , THR C:136 , GLY C:141 , SER C:142 , TRP C:166 , ILE C:167 , THR C:168 , ILE C:371 , ILE C:374 , TYR C:375 , THR C:378 , GLN C:380 , ARG D:281 , THR D:283 , PHE D:284 , LEU D:288 , HIS D:291 , GLN D:349 , ILE D:350 , GLY D:352 , GLY D:353	BINDING SITE FOR RESIDUE FAD C 399
5	AC5	SOFTWARE	GLN A:292 , ARG C:281 , THR C:283 , PHE C:284 , LEU C:288 , HIS C:291 , GLN C:349 , ILE C:350 , GLY C:353 , TYR D:133 , VAL D:135 , THR D:136 , GLY D:141 , SER D:142 , TRP D:166 , THR D:168 , ASN D:214 , ILE D:371 , ILE D:374 , TYR D:375 , GLU D:376 , THR D:378 , GLN D:380	BINDING SITE FOR RESIDUE FAD D 399

(no "SS Bond" information available for 1T9G)

(no "Cis Peptide Bond" information available for 1T9G)

Asymmetric/Biological Unit (26, 86)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000317	R	53	C	ACADM_HUMAN	Disease (ACADMD)	398123072	A/B/C/D	R	28	C
02	UniProt	VAR_013698	Y	67	H	ACADM_HUMAN	Disease (ACADMD)	121434280	A/B/C/D	Y	42	H
03	UniProt	VAR_015954	I	78	T	ACADM_HUMAN	Disease (ACADMD)	398123074	A/B/C/D	I	53	T
04	UniProt	VAR_015955	C	116	Y	ACADM_HUMAN	Disease (ACADMD)	875989859	A/B/C/D	C	91	Y
05	UniProt	VAR_015956	T	121	I	ACADM_HUMAN	Disease (ACADMD)	121434283	A/B/C/D	T	96	I
06	UniProt	VAR_035716	P	132	R	ACADM_HUMAN	Unclassified	875989854	A/B/C/D	P	107	R
07	UniProt	VAR_002366	G	116	R	ETFA_HUMAN	Disease (GA2A)	119458971	R	G	116	R
08	UniProt	VAR_000319	M	149	I	ACADM_HUMAN	Disease (ACADMD)	121434277	A/B/C/D	M	124	I
09	UniProt	VAR_025804	D	128	N	ETFB_HUMAN	Disease (GA2B)	104894678	S	D	128	N
10	UniProt	VAR_008548	T	154	M	ETFB_HUMAN	Polymorphism	1130426	S	T	154	M
11	UniProt	VAR_002367	V	157	G	ETFA_HUMAN	Disease (GA2A)	119458969	R	V	157	G
12	UniProt	VAR_002369	R	164	Q	ETFB_HUMAN	Disease (GA2B)	104894677	S	R	164	Q
13	UniProt	VAR_000320	T	193	A	ACADM_HUMAN	Disease (ACADMD)	121434279	A/B/C/D	T	168	A
14	UniProt	VAR_000321	G	195	R	ACADM_HUMAN	Disease (ACADMD)	121434278	A/B/C/D	G	170	R
15	UniProt	VAR_008547	T	171	I	ETFA_HUMAN	Polymorphism	1801591	R	T	171	I
16	UniProt	VAR_015957	R	206	L	ACADM_HUMAN	Disease (ACADMD)	---	A/B/C/D	R	181	L
17	UniProt	VAR_000322	C	244	R	ACADM_HUMAN	Disease (ACADMD)	121434276	A/B/C/D	C	219	R
18	UniProt	VAR_013699	S	245	L	ACADM_HUMAN	Disease (ACADMD)	121434281	A/B/C/D	S	220	L
19	UniProt	VAR_000323	G	267	R	ACADM_HUMAN	Disease (ACADMD)	121434274	A/B/C/D	G	242	R
20	UniProt	VAR_013700	R	281	T	ACADM_HUMAN	Disease (ACADMD)	121434282	A/B/C/D	R	256	T
21	UniProt	VAR_015958	G	310	R	ACADM_HUMAN	Disease (ACADMD)	747268471	A/B/C/D	G	285	R
22	UniProt	VAR_000324	M	326	T	ACADM_HUMAN	Disease (ACADMD)	786204631	A/B/C/D	M	301	T
23	UniProt	VAR_000325	K	329	E	ACADM_HUMAN	Disease (ACADMD)	77931234	A/B/C/D	K	304	E
24	UniProt	VAR_000326	S	336	R	ACADM_HUMAN	Disease (ACADMD)	---	A/B/C/D	S	311	R
25	UniProt	VAR_015959	Y	352	C	ACADM_HUMAN	Disease (ACADMD)	---	A/B/C/D	Y	327	C
26	UniProt	VAR_000327	I	375	T	ACADM_HUMAN	Disease (ACADMD)	121434275	A/B/C/D	I	350	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (3, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACYL_COA_DH_1	PS00072	Acyl-CoA dehydrogenases signature 1.	ACADM_HUMAN	159-171	4	A:134-146 B:134-146 C:134-146 D:134-146
2	ETF_BETA	PS01065	Electron transfer flavoprotein beta-subunit signature.	ETFB_HUMAN	162-182	1	S:162-182
3	ACYL_COA_DH_2	PS00073	Acyl-CoA dehydrogenases signature 2.	ACADM_HUMAN	374-393	4	A:349-368 B:349-368 C:349-368 D:349-368

Asymmetric/Biological Unit (17, 50)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000309244	1	ENSE00001384271	chr19:51869672-51869524	149	ETFB_HUMAN	1-19	19	1	S:4-19	16
1.2b	ENST00000309244	2b	ENSE00001225639	chr19:51857562-51857404	159	ETFB_HUMAN	20-72	53	1	S:20-72	53
1.3	ENST00000309244	3	ENSE00000722381	chr19:51856544-51856386	159	ETFB_HUMAN	73-125	53	1	S:73-125	53
1.4	ENST00000309244	4	ENSE00000722391	chr19:51853645-51853583	63	ETFB_HUMAN	126-146	21	1	S:126-146	21
1.5	ENST00000309244	5	ENSE00000722401	chr19:51850312-51850154	159	ETFB_HUMAN	147-199	53	1	S:147-199	53
1.6	ENST00000309244	6	ENSE00001471664	chr19:51848635-51848410	226	ETFB_HUMAN	200-255	56	1	S:200-231	32

2.1a	ENST00000370841	1a	ENSE00001844831	chr1:76190036-76190502	467	ACADM_HUMAN	1-10	10	0	-	-
2.2b	ENST00000370841	2b	ENSE00000830661	chr1:76194086-76194173	88	ACADM_HUMAN	11-40	30	4	A:10-15 B:10-15 C:9-15 D:10-15	6 6 7 6
2.3b	ENST00000370841	3b	ENSE00000830662	chr1:76198329-76198426	98	ACADM_HUMAN	40-72	33	4	A:15-47 B:15-47 C:15-47 D:15-47	33 33 33 33
2.4b	ENST00000370841	4b	ENSE00000830663	chr1:76198538-76198607	70	ACADM_HUMAN	73-96	24	4	A:48-71 B:48-71 C:48-71 D:48-71	24 24 24 24
2.4g	ENST00000370841	4g	ENSE00000830664	chr1:76199213-76199313	101	ACADM_HUMAN	96-129	34	4	A:71-104 B:71-104 C:71-104 D:71-104	34 34 34 34
2.5b	ENST00000370841	5b	ENSE00000830665	chr1:76200476-76200556	81	ACADM_HUMAN	130-156	27	4	A:105-131 B:105-131 C:105-131 D:105-131	27 27 27 27
2.6	ENST00000370841	6	ENSE00000830666	chr1:76205665-76205795	131	ACADM_HUMAN	157-200	44	4	A:132-175 B:132-175 C:132-175 D:132-175	44 44 44 44
2.7b	ENST00000370841	7b	ENSE00000830671	chr1:76211491-76211599	109	ACADM_HUMAN	200-236	37	4	A:175-211 B:175-211 C:175-211 D:175-211	37 37 37 37
2.8d	ENST00000370841	8d	ENSE00000931972	chr1:76215104-76215244	141	ACADM_HUMAN	237-283	47	4	A:212-258 B:212-258 C:212-258 D:212-258	47 47 47 47
2.9a	ENST00000370841	9a	ENSE00000931973	chr1:76216136-76216231	96	ACADM_HUMAN	284-315	32	4	A:259-290 B:259-290 C:259-290 D:259-290	32 32 32 32
2.12c	ENST00000370841	12c	ENSE00000931974	chr1:76226807-76227055	249	ACADM_HUMAN	316-398	83	4	A:291-373 B:291-373 C:291-373 D:291-373	83 83 83 83
2.13f	ENST00000370841	13f	ENSE00001513957	chr1:76228377-76229364	988	ACADM_HUMAN	399-421	23	4	A:374-395 B:374-396 C:374-396 D:374-396	22 23 23 23

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:386
 aligned with ACADM_HUMAN | P11310 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:386
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414      
          ACADM_HUMAN    35 LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK 420
               SCOP domains d1t9ga2 A:10-241 Medium chain acyl-CoA dehydrogenase, NM domains                                                                                                                                                                        d1t9ga1 A:242-395 Medium chain acyl-CoA dehydrogenase, C-domain                                                                                            SCOP domains
               CATH domains --1t9gA01 A:12-130 Butyryl-Coa Dehydrogenase, subunit A, domain 1                                                        1t9gA02 A:131-251 Butyryl-CoA Dehydrogenase, subunit A, domain 2                                                         1t9gA03 A:252-392 Butyryl-CoA Dehydrogenase, subunit A, domain 3                                                                             --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh.......hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee........hhhhh..eeee...eeeeeeeeeeee......eeeeeee.......hhhhheeeeeee.....eeeeee..........eeeeeeeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------C-------------H----------T-------------------------------------Y----I----------R----------------I-------------------------------------------A-R----------L-------------------------------------RL---------------------R-------------T----------------------------R---------------T--E------R---------------C----------------------T--------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_2       --------------------------- PROSITE
           Transcript 2 (1) 2.2b  --------------------------------Exon 2.4b  PDB: A:48-71 ---------------------------------Exon 2.5b  PDB: A:105-131  Exon 2.6  PDB: A:132-175 UniProt: 157-200   ------------------------------------Exon 2.8d  PDB: A:212-258 UniProt: 237-283     Exon 2.9a  PDB: A:259-290       Exon 2.12c  PDB: A:291-373 UniProt: 316-398                                        Exon 2.13f             Transcript 2 (1)
           Transcript 2 (2) -----Exon 2.3b  PDB: A:15-47          -----------------------Exon 2.4g  PDB: A:71-104          ----------------------------------------------------------------------Exon 2.7b  PDB: A:175-211            ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 1t9g A  10 LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK 395
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389

Chain B from PDB  Type:PROTEIN  Length:387
 aligned with ACADM_HUMAN | P11310 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:387
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       
          ACADM_HUMAN    35 LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN 421
               SCOP domains d1t9gb2 B:10-241 Medium chain acyl-CoA dehydrogenase, NM domains                                                                                                                                                                        d1t9gb1 B:242-395 Medium chain acyl-CoA dehydrogenase, C-domain                                                                                           - SCOP domains
               CATH domains --1t9gB01 B:12-130 Butyryl-Coa Dehydrogenase, subunit A, domain 1                                                        1t9gB02 B:131-251 Butyryl-CoA Dehydrogenase, subunit A, domain 2                                                         1t9gB03 B:252-392 Butyryl-CoA Dehydrogenase, subunit A, domain 3                                                                             ---- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh......hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeee........hhhhh..eeee...eeeeeeeeeeee......eeeeeee.......hhhhheeeeeee.....eeeeee..........eeeeeeeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------C-------------H----------T-------------------------------------Y----I----------R----------------I-------------------------------------------A-R----------L-------------------------------------RL---------------------R-------------T----------------------------R---------------T--E------R---------------C----------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_2       ---------------------------- PROSITE
           Transcript 2 (1) 2.2b  --------------------------------Exon 2.4b  PDB: B:48-71 ---------------------------------Exon 2.5b  PDB: B:105-131  Exon 2.6  PDB: B:132-175 UniProt: 157-200   ------------------------------------Exon 2.8d  PDB: B:212-258 UniProt: 237-283     Exon 2.9a  PDB: B:259-290       Exon 2.12c  PDB: B:291-373 UniProt: 316-398                                        Exon 2.13f              Transcript 2 (1)
           Transcript 2 (2) -----Exon 2.3b  PDB: B:15-47          -----------------------Exon 2.4g  PDB: B:71-104          ----------------------------------------------------------------------Exon 2.7b  PDB: B:175-211            ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 1t9g B  10 LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN 396
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389

Chain C from PDB  Type:PROTEIN  Length:388
 aligned with ACADM_HUMAN | P11310 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:388
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413        
          ACADM_HUMAN    34 GLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN 421
               SCOP domains -d1t9gc2 C:10-241 Medium chain acyl-CoA dehydrogenase, NM domains                                                                                                                                                                        d1t9gc1 C:242-395 Medium chain acyl-CoA dehydrogenase, C-domain                                                                                           - SCOP domains
               CATH domains ---1t9gC01 C:12-130 Butyryl-Coa Dehydrogenase, subunit A, domain 1                                                        1t9gC02 C:131-251 Butyryl-CoA Dehydrogenase, subunit A, domain 2                                                         1t9gC03 C:252-392 Butyryl-CoA Dehydrogenase, subunit A, domain 3                                                                             ---- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh.......hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee........hhhhh..eeee...eeeeeeeeeeee....eeeeeeeee.......hhhhheeeeeee.....eee.............eeeeeeeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhee..ee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------C-------------H----------T-------------------------------------Y----I----------R----------------I-------------------------------------------A-R----------L-------------------------------------RL---------------------R-------------T----------------------------R---------------T--E------R---------------C----------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_2       ---------------------------- PROSITE
           Transcript 2 (1) 2.2b   --------------------------------Exon 2.4b  PDB: C:48-71 ---------------------------------Exon 2.5b  PDB: C:105-131  Exon 2.6  PDB: C:132-175 UniProt: 157-200   ------------------------------------Exon 2.8d  PDB: C:212-258 UniProt: 237-283     Exon 2.9a  PDB: C:259-290       Exon 2.12c  PDB: C:291-373 UniProt: 316-398                                        Exon 2.13f              Transcript 2 (1)
           Transcript 2 (2) ------Exon 2.3b  PDB: C:15-47          -----------------------Exon 2.4g  PDB: C:71-104          ----------------------------------------------------------------------Exon 2.7b  PDB: C:175-211            ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 1t9g C   9 GLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN 396
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388

Chain D from PDB  Type:PROTEIN  Length:387
 aligned with ACADM_HUMAN | P11310 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:387
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       
          ACADM_HUMAN    35 LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN 421
               SCOP domains d1t9gd2 D:10-241 Medium chain acyl-CoA dehydrogenase, NM domains                                                                                                                                                                        d1t9gd1 D:242-395 Medium chain acyl-CoA dehydrogenase, C-domain                                                                                           - SCOP domains
               CATH domains --1t9gD01 D:12-130 Butyryl-Coa Dehydrogenase, subunit A, domain 1                                                        1t9gD02 D:131-251 Butyryl-CoA Dehydrogenase, subunit A, domain 2                                                         1t9gD03 D:252-392 Butyryl-CoA Dehydrogenase, subunit A, domain 3                                                                             ---- CATH domains
           Pfam domains (1) -------Acyl-CoA_dh_N-1t9gD09 D:17-128                                                                                  ---Acyl-CoA_dh_M-1t9gD05 D:132-183                     ----------------------------------------------------------Acyl-CoA_dh_1-1t9gD01 D:242-391                                                                                                                       ----- Pfam domains (1)
           Pfam domains (2) -------Acyl-CoA_dh_N-1t9gD10 D:17-128                                                                                  ---Acyl-CoA_dh_M-1t9gD06 D:132-183                     ----------------------------------------------------------Acyl-CoA_dh_1-1t9gD02 D:242-391                                                                                                                       ----- Pfam domains (2)
           Pfam domains (3) -------Acyl-CoA_dh_N-1t9gD11 D:17-128                                                                                  ---Acyl-CoA_dh_M-1t9gD07 D:132-183                     ----------------------------------------------------------Acyl-CoA_dh_1-1t9gD03 D:242-391                                                                                                                       ----- Pfam domains (3)
           Pfam domains (4) -------Acyl-CoA_dh_N-1t9gD12 D:17-128                                                                                  ---Acyl-CoA_dh_M-1t9gD08 D:132-183                     ----------------------------------------------------------Acyl-CoA_dh_1-1t9gD04 D:242-391                                                                                                                       ----- Pfam domains (4)
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh......hhhhh....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee........hhhhh..eeeee..eeeeeeeeeeee....eeeeeeeee.......hhhhheeeeeee.....eee.............eeeeeeeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhee..ee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------C-------------H----------T-------------------------------------Y----I----------R----------------I-------------------------------------------A-R----------L-------------------------------------RL---------------------R-------------T----------------------------R---------------T--E------R---------------C----------------------T---------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACYL_COA_DH_2       ---------------------------- PROSITE
           Transcript 2 (1) 2.2b  --------------------------------Exon 2.4b  PDB: D:48-71 ---------------------------------Exon 2.5b  PDB: D:105-131  Exon 2.6  PDB: D:132-175 UniProt: 157-200   ------------------------------------Exon 2.8d  PDB: D:212-258 UniProt: 237-283     Exon 2.9a  PDB: D:259-290       Exon 2.12c  PDB: D:291-373 UniProt: 316-398                                        Exon 2.13f              Transcript 2 (1)
           Transcript 2 (2) -----Exon 2.3b  PDB: D:15-47          -----------------------Exon 2.4g  PDB: D:71-104          ----------------------------------------------------------------------Exon 2.7b  PDB: D:175-211            ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 1t9g D  10 LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN 396
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389

Chain R from PDB  Type:PROTEIN  Length:184
 aligned with ETFA_HUMAN | P13804 from UniProtKB/Swiss-Prot  Length:333

    Alignment length:184
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199    
           ETFA_HUMAN    20 QSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQK 203
               SCOP domains d1t9gr_ R: Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain                                                                                                SCOP domains
               CATH domains 1t9gR00 R:20-203 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                   CATH domains
               Pfam domains -ETF-1t9gR01 R:21-175                                                                                                                                       ---------------------------- Pfam domains
         Sec.struct. author ..eeee.........hhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeeeee.hhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhh...eeee.eeee..eeeeee....eeeeee.....eeeee.hhhh..........eeee.........eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------R----------------------------------------G-------------I-------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1t9g R  20 QSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQK 203
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199

Chain S from PDB  Type:PROTEIN  Length:228
 aligned with ETFB_HUMAN | P38117 from UniProtKB/Swiss-Prot  Length:255

    Alignment length:228
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223        
           ETFB_HUMAN     4 LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP 231
               SCOP domains d1t9gs_ S: Small, beta subunit of electron transfer flavoprotein ETFP                                                                                                                                                                SCOP domains
               CATH domains 1t9gS00 S:4-231 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                CATH domains
               Pfam domains ----------------------ETF-1t9gS01 S:26-190                                                                                                                                                 ----------------------------------------- Pfam domains
         Sec.struct. author .eeeee..eee.....................eeehhhhhhhhhhhhhhhhh....eeeeeeee..hhhhhhhhhhhh...eeeeee.........hhhhhhhhhhhhhhhh...eeeee.........hhhhhhhhhh...eeeeeee..ee..eeeeeee....eeeeeee..eeeee.hhhh.....hhhhhhhhhhh.eeeehhhhhh........eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------N-------------------------M---------Q------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------ETF_BETA             ------------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.1        Exon 1.2b  PDB: S:20-72 UniProt: 20-72               Exon 1.3  PDB: S:73-125 UniProt: 73-125              Exon 1.4             Exon 1.5  PDB: S:147-199 UniProt: 147-199            Exon 1.6  PDB: S:200-231         Transcript 1
                 1t9g S   4 LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP 231
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Acyl-CoA_dh (32)

Family: Acyl-CoA_dh_1 (24)

Homo sapiens (Human) (10)

1a	Acyl-CoA_dh_1-1t9gD01	D:242-391
1b	Acyl-CoA_dh_1-1t9gD02	D:242-391
1c	Acyl-CoA_dh_1-1t9gD03	D:242-391
1d	Acyl-CoA_dh_1-1t9gD04	D:242-391

Clan: HUP (230)

Family: ETF (4)

Homo sapiens (Human) (1)

2a	ETF-1t9gR01	R:21-175
2b	ETF-1t9gS01	S:26-190

Clan: no clan defined [family: Acyl-CoA_dh_M] (24)

Family: Acyl-CoA_dh_M (24)

Homo sapiens (Human) (10)

3a	Acyl-CoA_dh_M-1t9gD05	D:132-183
3b	Acyl-CoA_dh_M-1t9gD06	D:132-183
3c	Acyl-CoA_dh_M-1t9gD07	D:132-183
3d	Acyl-CoA_dh_M-1t9gD08	D:132-183

Clan: no clan defined [family: Acyl-CoA_dh_N] (23)

Family: Acyl-CoA_dh_N (23)

Homo sapiens (Human) (10)

4a	Acyl-CoA_dh_N-1t9gD09	D:17-128
4b	Acyl-CoA_dh_N-1t9gD10	D:17-128
4c	Acyl-CoA_dh_N-1t9gD11	D:17-128
4d	Acyl-CoA_dh_N-1t9gD12	D:17-128

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (ACADM_HUMAN | P11310)

molecular function
	GO:0003995	acyl-CoA dehydrogenase activity	Catalysis of the reaction: acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0000062	fatty-acyl-CoA binding	Interacting selectively and non-covalently with acyl-CoA, any derivative of coenzyme A in which the sulfhydryl group is in thiolester linkage with a fatty acyl group.
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0070991	medium-chain-acyl-CoA dehydrogenase activity	Catalysis of the reaction: acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor, where the acyl group is a medium-chain fatty acid residue. A medium chain fatty acid is any fatty acid with a chain length of between C6 and C12.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
	GO:0052890	oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a flavin.
biological process
	GO:0045329	carnitine biosynthetic process	The chemical reactions and pathways resulting in the formation of carnitine (hydroxy-trimethyl aminobutyric acid), a compound that participates in the transfer of acyl groups across the inner mitochondrial membrane.
	GO:0019254	carnitine metabolic process, CoA-linked	The chemical reactions and pathways involving carnitine, where metabolism is linked to CoA.
	GO:0006635	fatty acid beta-oxidation	A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase	A fatty acid beta-oxidation pathway in which the initial step of each oxidation cycle, which converts an acyl-CoA to a trans-2-enoyl-CoA, is catalyzed by acyl-CoA dehydrogenase; the electrons removed by oxidation pass through the respiratory chain to oxygen and leave H2O as the product. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and ends when only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0055088	lipid homeostasis	Any process involved in the maintenance of an internal steady state of lipid within an organism or cell.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0051793	medium-chain fatty acid catabolic process	The chemical reactions and pathways resulting in the breakdown of any fatty acid with a chain length of between C6 and C12.
	GO:0051791	medium-chain fatty acid metabolic process	The chemical reactions and pathways involving medium-chain fatty acids, any fatty acid with a chain length of between C6 and C12.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Chain R (ETFA_HUMAN | P13804)

molecular function
	GO:0003995	acyl-CoA dehydrogenase activity	Catalysis of the reaction: acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0000062	fatty-acyl-CoA binding	Interacting selectively and non-covalently with acyl-CoA, any derivative of coenzyme A in which the sulfhydryl group is in thiolester linkage with a fatty acyl group.
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0052890	oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a flavin.
biological process
	GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase	A fatty acid beta-oxidation pathway in which the initial step of each oxidation cycle, which converts an acyl-CoA to a trans-2-enoyl-CoA, is catalyzed by acyl-CoA dehydrogenase; the electrons removed by oxidation pass through the respiratory chain to oxygen and leave H2O as the product. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and ends when only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0055088	lipid homeostasis	Any process involved in the maintenance of an internal steady state of lipid within an organism or cell.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Chain S (ETFB_HUMAN | P38117)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
biological process
	GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase	A fatty acid beta-oxidation pathway in which the initial step of each oxidation cycle, which converts an acyl-CoA to a trans-2-enoyl-CoA, is catalyzed by acyl-CoA dehydrogenase; the electrons removed by oxidation pass through the respiratory chain to oxygen and leave H2O as the product. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and ends when only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AMP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1t9g)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1t9g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACADM_HUMAN \| P11310
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ETFA_HUMAN \| P13804
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ETFB_HUMAN \| P38117
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.3.99.3
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	201450
		Disease Information	:	OMIM
	231680
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACADM_HUMAN \| P11310
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ETFA_HUMAN \| P13804
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ETFB_HUMAN \| P38117
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ACADM_HUMAN \| P11310	:	1egc 1egd 1ege 2a1t 4p13
	ETFA_HUMAN \| P13804	:	1efv 2a1t 2a1u
	ETFB_HUMAN \| P38117	:	1efv 2a1t 2a1u

1efv	THREE-DIMENSIONAL STRUCTURE OF HUMAN ELECTRON TRANSFER FLAVOPROTEIN TO 2.1 A RESOLUTION
1o94	STRUCTURE OF THE BACTERIAL TMADH:ETF COMPLEX
1udy	MEDIUM-CHAIN ACYL-COA DEHYDROGENASE WITH 3-THIAOCTANOYL-COA

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (26, 86)

PROSITE Motifs (3, 9)

Exons (17, 50)

Sequences/Alignments

Classification and Annotation

SCOP Domains (4, 10)

CATH Domains (4, 14)

Pfam Domains (4, 14)

Gene Ontology (28, 47)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File