Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HUMAN O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE COVALENTLY CROSSLINKED TO DNA
 
Authors :  D. S. Daniels, T. T. Woo, K. X. Luu, D. M. Noll, N. D. Clarke, A. E. Pegg, J. A. Tainer
Date :  25 Apr 04  (Deposition) - 13 Jul 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.30
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,C,D  (1x)
Biol. Unit 2:  B,E,F  (1x)
Keywords :  Alkyltransferase, Methyltransferase, Dna Repair, Helix-Turn- Helix, Transferase/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. S. Daniels, T. T. Woo, K. X. Luu, D. M. Noll, N. D. Clarke, A. E. Pegg, J. A. Tainer
Dna Binding And Nucleotide Flipping By The Human Dna Repair Protein Agt.
Nat. Struct. Mol. Biol. V. 11 714 2004
PubMed-ID: 15221026  |  Reference-DOI: 10.1038/NSMB791
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)- 3'
    ChainsC, E
    EngineeredYES
    SyntheticYES
 
Molecule 2 - 5'-D(*TP*AP*CP*TP*AP*GP*CP*CP*AP*TP*GP*GP*C)-3'
    ChainsD, F
    EngineeredYES
    SyntheticYES
 
Molecule 3 - METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
    ChainsA, B
    EC Number2.1.1.63
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE30
    Expression System StrainJM109
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneMGMT
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym6-O- METHYLGUANINE-DNA METHYLTRANSFERASE

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A CD  
Biological Unit 2 (1x) B  EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1E1X2Mod. NucleotidePHOSPHORIC ACID MONO-[5-(1-ETHYL-2,6-DIOXO-1,2,3,6-TETRAHYDRO-PURIN-9-YL)-3-HYDROXY-TETRAHYDRO-FURAN-2-YLMETHYL]ESTER
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1E1X1Mod. NucleotidePHOSPHORIC ACID MONO-[5-(1-ETHYL-2,6-DIOXO-1,2,3,6-TETRAHYDRO-PURIN-9-YL)-3-HYDROXY-TETRAHYDRO-FURAN-2-YLMETHYL]ESTER
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1E1X1Mod. NucleotidePHOSPHORIC ACID MONO-[5-(1-ETHYL-2,6-DIOXO-1,2,3,6-TETRAHYDRO-PURIN-9-YL)-3-HYDROXY-TETRAHYDRO-FURAN-2-YLMETHYL]ESTER

(-) Sites  (0, 0)

(no "Site" information available for 1T39)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1T39)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1T39)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 16)

Asymmetric Unit (8, 16)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014750E30KMGMT_HUMANPolymorphism2020893A/BE30K
2UniProtVAR_029112P58SMGMT_HUMANPolymorphism2308322A/BP58S
3UniProtVAR_020354W65CMGMT_HUMANPolymorphism2282164A/BW65C
4UniProtVAR_014751L84FMGMT_HUMANPolymorphism12917A/BL84F
5UniProtVAR_056130I112VMGMT_HUMANPolymorphism2308321A/BI112V
6UniProtVAR_014752I143VMGMT_HUMANPolymorphism2308321A/BI143V
7UniProtVAR_014753G160RMGMT_HUMANPolymorphism2308318A/BG160R
8UniProtVAR_014754E166DMGMT_HUMANPolymorphism2308320A/BE166D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014750E30KMGMT_HUMANPolymorphism2020893AE30K
2UniProtVAR_029112P58SMGMT_HUMANPolymorphism2308322AP58S
3UniProtVAR_020354W65CMGMT_HUMANPolymorphism2282164AW65C
4UniProtVAR_014751L84FMGMT_HUMANPolymorphism12917AL84F
5UniProtVAR_056130I112VMGMT_HUMANPolymorphism2308321AI112V
6UniProtVAR_014752I143VMGMT_HUMANPolymorphism2308321AI143V
7UniProtVAR_014753G160RMGMT_HUMANPolymorphism2308318AG160R
8UniProtVAR_014754E166DMGMT_HUMANPolymorphism2308320AE166D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014750E30KMGMT_HUMANPolymorphism2020893BE30K
2UniProtVAR_029112P58SMGMT_HUMANPolymorphism2308322BP58S
3UniProtVAR_020354W65CMGMT_HUMANPolymorphism2282164BW65C
4UniProtVAR_014751L84FMGMT_HUMANPolymorphism12917BL84F
5UniProtVAR_056130I112VMGMT_HUMANPolymorphism2308321BI112V
6UniProtVAR_014752I143VMGMT_HUMANPolymorphism2308321BI143V
7UniProtVAR_014753G160RMGMT_HUMANPolymorphism2308318BG160R
8UniProtVAR_014754E166DMGMT_HUMANPolymorphism2308320BE166D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MGMTPS00374 Methylated-DNA--protein-cysteine methyltransferase active site.MGMT_HUMAN143-149
 
  2A:143-149
B:143-149
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MGMTPS00374 Methylated-DNA--protein-cysteine methyltransferase active site.MGMT_HUMAN143-149
 
  1A:143-149
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MGMTPS00374 Methylated-DNA--protein-cysteine methyltransferase active site.MGMT_HUMAN143-149
 
  1-
B:143-149

(-) Exons   (0, 0)

(no "Exon" information available for 1T39)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:151
 aligned with MGMT_HUMAN | P16455 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:171
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174 
           MGMT_HUMAN     5 CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR 175
               SCOP domains -d1t39a2 A:6-91 O6-alkylguanine                    -DNA alkyltransferase               d1t39a1 A:92-175 O6-alkylguanine-DNA alkyltransferase                                SCOP domains
               CATH domains -1t39A01 A:6-85 O6-alkylguanine                    -DNA Alkyltransferase; Chain A1t39A02 A:86-175 'winged helix' repressor DNA binding domain                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..ee..ee..eeee..ee.......--------------------hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhh......eehhhhhhhh.....hhhhhhhhhh...........ee...........hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------K---------------------------S------C------------------F---------------------------V------------------------------V----------------R-----D--------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------MGMT   -------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1t39 A   5 CEMKRTTLDSPLGKLELSGCEQGLHEIKLLG--------------------PEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR 175
                                    14        24        34|        -         - |      64        74        84        94       104       114       124       134       144       154       164       174 
                                                         35                   56                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:148
 aligned with MGMT_HUMAN | P16455 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:168
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166        
           MGMT_HUMAN     7 MKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGH 174
               SCOP domains d1t39b2 B:7-91 O6-alkylguanin                    e-DNA alkyltransferase              d1t39b1 B:92-174 O6-alkylguanine-DNA alkyltransferase                               SCOP domains
               CATH domains 1t39B01 B:7-85 O6-alkylguanin                    e-DNA Alkyltransferase; Chain 1t39B02 B:86-174 'winged helix' repressor DNA binding domain                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......ee..ee....ee..ee.......--------------------hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhh......eehhhhhhhh....hhhhhhhhhhh...........ee...........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------K---------------------------S------C------------------F---------------------------V------------------------------V----------------R-----D-------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------MGMT   ------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1t39 B   7 MKRTTLDSPLGKLELSGCEQGLHEIKLLG--------------------PEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGH 174
                                    16        26        |-         -        56        66        76        86        96       106       116       126       136       146       156       166        
                                                       35                   56                                                                                                                      

Chain C from PDB  Type:DNA  Length:13
                                             
                 1t39 C   1 GCCATGaCTAGTA  13
                                  | 10   
                                  7-E1X  

Chain D from PDB  Type:DNA  Length:13
                                             
                 1t39 D  14 TACTAGCCATGGC  26
                                    23   

Chain E from PDB  Type:DNA  Length:13
                                             
                 1t39 E   1 GCCATGaCTAGTA  13
                                  | 10   
                                  7-E1X  

Chain F from PDB  Type:DNA  Length:13
                                             
                 1t39 F  14 TACTAGCCATGGC  26
                                    23   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1T39)

(-) Gene Ontology  (32, 32)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (MGMT_HUMAN | P16455)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0009008    DNA-methyltransferase activity    Catalysis of the transfer of a methyl group to a DNA molecule.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003908    methylated-DNA-[protein]-cysteine S-methyltransferase activity    Catalysis of the reaction: DNA (containing 6-O-methylguanine) + (protein)-L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L-cysteine.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006307    DNA dealkylation involved in DNA repair    The repair of alkylation damage, e.g. the removal of the alkyl group at the O6-position of guanine by O6-alkylguanine-DNA alkyltransferase (AGT).
    GO:0006266    DNA ligation    The re-formation of a broken phosphodiester bond in the DNA backbone, carried out by DNA ligase.
    GO:0006306    DNA methylation    The covalent transfer of a methyl group to either N-6 of adenine or C-5 or N-4 of cytosine.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0071479    cellular response to ionizing radiation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
    GO:0071407    cellular response to organic cyclic compound    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0034599    cellular response to oxidative stress    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
    GO:0060644    mammary gland epithelial cell differentiation    The process in which a relatively unspecialized epithelial cell becomes a more specialized epithelial cell of the mammary gland.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0060548    negative regulation of cell death    Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
    GO:0045739    positive regulation of DNA repair    Any process that activates or increases the frequency, rate or extent of DNA repair.
    GO:2000781    positive regulation of double-strand break repair    Any process that activates or increases the frequency, rate or extent of double-strand break repair.
    GO:0043281    regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that modulates the activity of a cysteine-type endopeptidase involved in apoptosis.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0051593    response to folic acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a folic acid stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0009636    response to toxic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    E1X  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1t39)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1t39)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1t39
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MGMT_HUMAN | P16455
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.63
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MGMT_HUMAN | P16455
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MGMT_HUMAN | P164551eh6 1eh7 1eh8 1qnt 1t38 1yfh

(-) Related Entries Specified in the PDB File

1eh6 NATIVE HUMAN AGT
1eh7 METHYLATED HUMAN AGT
1eh8 BENZYLATED HUMAN AGT
1t38 HUMAN O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE BOUND TO DNA CONTAINING O6-METHYLGUANINE