1S94 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE HABC DOMAIN OF NEURONAL SYNTAXIN FROM THE SQUID LOLIGO PEALEI

Authors :   A. Bracher, W. Weissenhorn

Date :   03 Feb 04 (Deposition) - 11 May 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.34

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Three Helix Bundle, Structural Plasticity, Endocytosis-Exocytosis Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Bracher, W. Weissenhorn
Crystal Structure Of The Habc Domain Of Neuronal Syntaxin From The Squid Loligo Pealei Reveals Conformational Plasticity At Its C-Terminus
Bmc Struct. Biol. V. 4 6 2004
PubMed-ID: 15113421 | Reference-DOI: 10.1186/1472-6807-4-6

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:109
 aligned with O46345_DORPE | O46345 from UniProtKB/TrEMBL  Length:292

    Alignment length:121
                                    40        50        60        70        80        90       100       110       120       130       140       150 
         O46345_DORPE    31 GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSAPQTDDQMKEELEELMTDIKRTANKVRGKLKTIELNIEQEEHSNKSSADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR 151
               SCOP domains d1s94a_ A: Syntaxin 1A N-terminal do       main                                                                           SCOP domains
               CATH domains 1s94A00 A:31-151  [code=1.20.58.70,        no name defined]                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.-------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s94 A  31 GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILS-------MKEELEELMTDIKRTANKVRGKLKTIELNIEQEE-----SADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR 151
                                    40        50        60     |   -   |    80        90       100      |  -  |    120       130       140       150 
                                                              66      74                              107   113

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with O46345_DORPE | O46345 from UniProtKB/TrEMBL  Length:292

    Alignment length:125
                                    41        51        61        71        81        91       101       111       121       131       141       151     
         O46345_DORPE    32 FMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSAPQTDDQMKEELEELMTDIKRTANKVRGKLKTIELNIEQEEHSNKSSADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKARIKRQM 156
               SCOP domains d1s94b_ B: Syntaxin 1A N-terminal domain                                                                                      SCOP domains
               CATH domains 1s94B00 B:32-156  [code=1.20.58.70, no name defined]                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.-------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s94 B  32 FMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSAPQTDDQMKEELEELMTDIKRTANKVRGKLKTIELNIEQ-------SADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKARIKRQM 156
                                    41        51        61        71        81        91       101   |     - |     121       131       141       151     
                                                                                                   105     113

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Asymmetric Unit(hide GO term definitions)

Chain A,B (O46345_DORPE | O46345)

molecular function
	GO:0005484	SNAP receptor activity	Acting as a marker to identify a membrane and interacting selectively with one or more SNAREs on another membrane to mediate membrane fusion.
	GO:0000149	SNARE binding	Interacting selectively and non-covalently with a SNARE (soluble N-ethylmaleimide-sensitive factor attached protein receptor) protein.
biological process
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0061025	membrane fusion	The membrane organization process that joins two lipid bilayers to form a single membrane.
	GO:0017157	regulation of exocytosis	Any process that modulates the frequency, rate or extent of exocytosis.
	GO:0016192	vesicle-mediated transport	A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1s94)

	Sites
(no "Sites" information available for 1s94)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s94)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1s94
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	O46345_DORPE \| O46345
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description