Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF NEURONAL SEC1 FROM SQUID
 
Authors :  A. Bracher, A. Perrakis, T. Dresbach, H. Betz, W. Weissenhorn
Date :  29 Mar 00  (Deposition) - 09 Aug 00  (Release) - 27 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Parallel Beta-Sheets, Left-Hand Turn Connection, Helical Bundle, Endocytosis-Exocytosis Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Bracher, A. Perrakis, T. Dresbach, H. Betz, W. Weissenhorn
The X-Ray Crystal Structure Of Neuronal Sec1 From Squid Sheds New Light On The Role Of This Protein In Exocytosis.
Structure Fold. Des. V. 8 685 2000
PubMed-ID: 10903948  |  Reference-DOI: 10.1016/S0969-2126(00)00156-8
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - S-SEC1
    Cellular LocationGIANT AXON
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE30
    Expression System Taxid562
    Organism ScientificLOLIGO PEALEI
    Organism Taxid6621

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 19)

Asymmetric/Biological Unit (1, 19)
No.NameCountTypeFull Name
1MSE19Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1EPU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EPU)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:536 -Pro A:537

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EPU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1EPU)

(-) Exons   (0, 0)

(no "Exon" information available for 1EPU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:546
 aligned with O62547_DORPE | O62547 from UniProtKB/TrEMBL  Length:591

    Alignment length:590
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591
         O62547_DORPE     2 ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYVNTGGNEVPEKEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRMGTAADKAGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGPRPSCQQPVSVRYGHWHKDKGQASYKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP 591
               SCOP domains d1epua_ A: Neuronal Sec1, NSec1                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1epuA01 A:2-129  [code=3.40.50.2060, no name defined]                                                                           --1epuA04 A:132-242,A:482-569  [code=3.40.50.1910, no name defined]                                              1epuA02 A:243-357 Syn           taxin Binding Protein 1; Chain A, doma        in 2                                 1epuA03 A:358-481  [code=1.25.40.60, no name defined]                                                                       1epuA04 A:132-242,A:482-569                           [code=3.40.50.1910, no name define---------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh.....eeeeehhhhhhhhhhhhhhhhhhh..eeeeee.......eeeeeeeeee..hhhhhhhhhhhh.......eeeeeeee....hhhhhhhhhhh.hhh.eeeeee.....eeee..eee...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhh.....hhhhhh..eeeeee.hhh.hhhhh...hhhhhhhhhh.....ee..-----------.ee.hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.--------....hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhhhhhhhhhhh................hhhhh........hhhhh..hhhhhhhhhhhh...............-------------------------....eeeeeee...hhhhhhhhhhhhh......eeeeee....hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1epu A   2 ALKTAVHEKImNDVVLAVKKNAEWKVLIVDQLSmRmVSACCKmHEImSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLmADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTmGEGPQKDRSQLLILDRGFDPISPLLHELTFQAmAYDLLPIENDVYKY-----------EVLLDEKDDLWVEmRHQHIAVVSQNVTKKLKQFADEKR--------GIKDLSQmLKKmPQYQKELSKYSTHLHLAEDCmKQYQQHVDKLCKVEQDLAmGTDADGEKIRDHmRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDmQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQmSRWTPYmKDImEAAVEDKLDTRHYPFLNGGG-------------------------KSGPRLIIFVVGGISYSEmRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP 591
                                    11|       21        31   | |  41  |   | 51        61        71        81   |    91       101       111       121       131       141       151       161       171       181       191       201       211    |  221       231       241       251       261 |       -   |   281      |291       301       311|      321      |331|      341       351 |     361       371|      381   |   391       401       411       421       431       441       451       461       471     | 481  |   |491       501      |  -         -         -  |    541       551|      561       571       581       591
                                     12-MSE                 35-MSE   44-MSE                                   85-MSE                                                                                                                            216-MSE                          249-MSE       263         275          288-MSE                 312      321      |   |                  353-MSE            372-MSE      385-MSE                                                 441-MSE                             477-MSE  |   |                 508                       534               552-MSE                                   
                                                              37-MSE     48-MSE                                                                                                                                                                                                                                                                                 328-MSE                                                                                                                                                     484-MSE                                                                                                       
                                                                                                                                                                                                                                                                                                                                                                    332-MSE                                                                                                                                                     488-MSE                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (4, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EPU)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (O62547_DORPE | O62547)
biological process
    GO:0006904    vesicle docking involved in exocytosis    The initial attachment of a vesicle membrane to a target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane, that contributes to exocytosis.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1epu)
 
  Cis Peptide Bonds
    Gly A:536 - Pro A:537   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1epu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O62547_DORPE | O62547
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O62547_DORPE | O62547
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        O62547_DORPE | O625471fvf 1fvh

(-) Related Entries Specified in the PDB File

1dn1 1DN1 CONTAINS THE RAT HOMOLOG NSEC1 IN COMPLEX WITH SYNTAXIN 1A