1RID - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   VACCINIA COMPLEMENT PROTEIN IN COMPLEX WITH HEPARIN

Authors :   V. K. Ganesh, S. A. Smith, G. J. Kotwal, K. H. M. Murthy

Date :   17 Nov 03 (Deposition) - 22 Jun 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Complement, Regulation, Scr, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. K. Ganesh, S. A. Smith, G. J. Kotwal, K. H. M. Murthy
Structure Of Vaccinia Complement Protein In Complex With Heparin And Potential Implications For Complement Regulation.
Proc. Natl. Acad. Sci. Usa V. 101 8924 2004
PubMed-ID: 15178763 | Reference-DOI: 10.1073/PNAS.0400744101

Molecule 1 - COMPLEMENT CONTROL PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Taxid	:	4922
	Gene	:	C3L
	Organism Scientific	:	VACCINIA VIRUS
	Organism Taxid	:	10254
	Strain	:	WR
	Synonym	:	VCP, SECRETORY PROTEIN 35, PROTEIN C3, 28 KDA PROTEIN

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 16)

No.	Name	Count	Type	Full Name
1	IDS	8	Ligand/Ion	2-O-SULFO-ALPHA-L-IDOPYRANURONIC ACID
2	SGN	8	Ligand/Ion	N,O6-DISULFO-GLUCOSAMINE

Biological Unit 1 (2, 8)

No.	Name	Count	Type	Full Name
1	IDS	4	Ligand/Ion	2-O-SULFO-ALPHA-L-IDOPYRANURONIC ACID
2	SGN	4	Ligand/Ion	N,O6-DISULFO-GLUCOSAMINE

Biological Unit 2 (2, 8)

No.	Name	Count	Type	Full Name
1	IDS	4	Ligand/Ion	2-O-SULFO-ALPHA-L-IDOPYRANURONIC ACID
2	SGN	4	Ligand/Ion	N,O6-DISULFO-GLUCOSAMINE

Asymmetric Unit (16, 16)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	SGN A:246 , HOH A:263 , HOH A:278 , HOH A:499 , CYS B:35 , LEU B:36 , PRO B:37	BINDING SITE FOR RESIDUE IDS A 245
02	AC2	SOFTWARE	LYS A:214 , IDS A:245 , IDS A:247 , HOH A:382 , HOH A:416 , HOH A:497 , HOH A:536 , HOH A:577 , HOH A:616 , LEU B:36 , HOH B:480	BINDING SITE FOR RESIDUE SGN A 246
03	AC3	SOFTWARE	LYS A:214 , CYS A:215 , TYR A:217 , TYR A:219 , SGN A:246 , SGN A:248 , HOH A:273 , HOH A:357 , HOH A:616 , ASN B:15	BINDING SITE FOR RESIDUE IDS A 247
04	AC4	SOFTWARE	TYR A:219 , LYS A:220 , IDS A:247 , IDS A:249 , HOH A:415 , HOH A:468 , HOH A:641 , ASN B:15 , THR B:19	BINDING SITE FOR RESIDUE SGN A 248
05	AC5	SOFTWARE	GLY A:218 , SGN A:248 , SGN A:250 , HOH A:297 , HOH A:669 , THR B:19	BINDING SITE FOR RESIDUE IDS A 249
06	AC6	SOFTWARE	LYS A:216 , TYR A:219 , ARG A:244 , IDS A:249 , IDS A:251 , HOH A:450 , HOH A:489 , HOH A:515	BINDING SITE FOR RESIDUE SGN A 250
07	AC7	SOFTWARE	ARG A:244 , SGN A:250 , SGN A:252 , HOH A:261 , HOH A:292 , HOH A:375 , HOH A:431 , HOH A:511 , HOH A:515 , HOH A:646 , HOH A:653	BINDING SITE FOR RESIDUE IDS A 251
08	AC8	SOFTWARE	IDS A:251 , HOH A:326 , HOH A:377 , HOH A:430 , HOH A:431 , HOH A:463 , HOH A:511	BINDING SITE FOR RESIDUE SGN A 252
09	AC9	SOFTWARE	PHE A:13 , SGN B:246 , HOH B:296 , HOH B:392 , HOH B:420 , HOH B:509 , HOH B:559 , HOH B:588 , HOH B:629 , HOH B:642	BINDING SITE FOR RESIDUE IDS B 245
10	BC1	SOFTWARE	LYS B:214 , IDS B:245 , IDS B:247 , HOH B:279 , HOH B:285 , HOH B:292 , HOH B:471 , HOH B:646 , HOH B:649	BINDING SITE FOR RESIDUE SGN B 246
11	BC2	SOFTWARE	LYS B:214 , CYS B:215 , SGN B:246 , SGN B:248 , HOH B:279 , HOH B:586	BINDING SITE FOR RESIDUE IDS B 247
12	BC3	SOFTWARE	TYR B:217 , LYS B:220 , IDS B:247 , IDS B:249 , HOH B:320 , HOH B:496 , HOH B:497 , HOH B:502 , HOH B:536	BINDING SITE FOR RESIDUE SGN B 248
13	BC4	SOFTWARE	TYR B:217 , GLY B:218 , SGN B:248 , SGN B:250 , HOH B:495 , HOH B:502 , HOH B:653	BINDING SITE FOR RESIDUE IDS B 249
14	BC5	SOFTWARE	LYS B:216 , TYR B:217 , TYR B:219 , ARG B:244 , IDS B:249 , IDS B:251 , HOH B:414 , HOH B:422 , HOH B:435 , HOH B:571	BINDING SITE FOR RESIDUE SGN B 250
15	BC6	SOFTWARE	ARG B:244 , SGN B:250 , SGN B:252 , HOH B:263 , HOH B:294 , HOH B:304 , HOH B:307 , HOH B:361 , HOH B:414 , HOH B:656	BINDING SITE FOR RESIDUE IDS B 251
16	BC7	SOFTWARE	IDS B:251 , HOH B:261 , HOH B:275 , HOH B:295 , HOH B:315 , HOH B:338 , HOH B:347 , HOH B:367 , HOH B:466	BINDING SITE FOR RESIDUE SGN B 252

Asymmetric Unit

No.	Residues
1	A:2	-	A:51
2	A:35	-	A:62
3	A:67	-	A:107
4	A:93	-	A:124
5	A:129	-	A:171
6	A:157	-	A:182
7	A:187	-	A:229
8	A:215	-	A:242
9	B:2	-	B:51
10	B:35	-	B:62
11	B:67	-	B:107
12	B:93	-	B:124
13	B:129	-	B:171
14	B:157	-	B:182
15	B:187	-	B:229
16	B:215	-	B:242

Asymmetric Unit

No.	Residues
1	Lys A:236	-	Pro A:237
2	Lys B:236	-	Pro B:237

(no "SAP(SNP)/Variant" information available for 1RID)

Asymmetric Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCC	19-83 84-145 146-203 204-263	6	- A:65-126 B:65-126 A:127-184 B:127-184 A:185-244 B:185-244
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	6	- A:65-126 B:65-126 A:127-184 B:127-184 A:185-244 B:185-244

Biological Unit 1 (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCC	19-83 84-145 146-203 204-263	3	- A:65-126 - A:127-184 - A:185-244 -
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	3	- A:65-126 - A:127-184 - A:185-244 -

Biological Unit 2 (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCC	19-83 84-145 146-203 204-263	3	- - B:65-126 - B:127-184 - B:185-244
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	3	- - B:65-126 - B:127-184 - B:185-244

(no "Exon" information available for 1RID)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:244
 aligned with VCP_VACCC | P68639 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:244
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259    
            VCP_VACCC    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 263
               SCOP domains d1rida1 A:1-64 Complement control protein                       d1rida2 A:65-126 Complement control protein                   d1rida3 A:127-184 Complement control protein              d1rida4 A:185-244 Complement control protein                 SCOP domains
               CATH domains 1ridA01 A:1-65 Complement Module, domain 1                       1ridA02 A:66-125 Complement Module, domain 1                -1ridA03 A:127-184 Complement Module, domain 1             1ridA04 A:185-234 Complement Module, domain 1     ---------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................ee........ee.......eeee..eee....ee..................................ee........................ee.............ee..............ee.....eee................eee....................................eee.....eee...eee....eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: A:65-126 UniProt: 84-145                          SUSHI  PDB: A:127-184 UniProt: 146-203                    SUSHI  PDB: A:185-244 UniProt: 204-263                       PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rid A   1 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain A from PDB  Type:PROTEIN  Length:244
 aligned with VCP_VACCW | P68638 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:244
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259    
            VCP_VACCW    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 263
               SCOP domains d1rida1 A:1-64 Complement control protein                       d1rida2 A:65-126 Complement control protein                   d1rida3 A:127-184 Complement control protein              d1rida4 A:185-244 Complement control protein                 SCOP domains
               CATH domains 1ridA01 A:1-65 Complement Module, domain 1                       1ridA02 A:66-125 Complement Module, domain 1                -1ridA03 A:127-184 Complement Module, domain 1             1ridA04 A:185-234 Complement Module, domain 1     ---------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................ee........ee.......eeee..eee....ee..................................ee........................ee.............ee..............ee.....eee................eee....................................eee.....eee...eee....eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: A:65-126 UniProt: 84-145                          SUSHI  PDB: A:127-184 UniProt: 146-203                    SUSHI  PDB: A:185-244 UniProt: 204-263                       PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rid A   1 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain B from PDB  Type:PROTEIN  Length:244
 aligned with VCP_VACCC | P68639 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:244
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259    
            VCP_VACCC    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 263
               SCOP domains d1ridb1 B:1-64 Complement control protein                       d1ridb2 B:65-126 Complement control protein                   d1ridb3 B:127-184 Complement control protein              d1ridb4 B:185-244 Complement control protein                 SCOP domains
               CATH domains 1ridB01 B:1-65 Complement Module, domain 1                       1ridB02 B:66-125 Complement Module, domain 1                -1ridB03 B:127-184 Complement Module, domain 1             1ridB04 B:185-234 Complement Module, domain 1     ---------- CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB01 B:187-242                                 -- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB02 B:187-242                                 -- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB03 B:187-242                                 -- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB04 B:187-242                                 -- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB05 B:187-242                                 -- Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB06 B:187-242                                 -- Pfam domains (6)
           Pfam domains (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB07 B:187-242                                 -- Pfam domains (7)
           Pfam domains (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB08 B:187-242                                 -- Pfam domains (8)
         Sec.struct. author .............................ee........ee.......eeee..eee....ee..................................ee........................ee.............ee..............ee.....eee................eee....................................eee.....eee...eee....eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: B:65-126 UniProt: 84-145                          SUSHI  PDB: B:127-184 UniProt: 146-203                    SUSHI  PDB: B:185-244 UniProt: 204-263                       PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rid B   1 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain B from PDB  Type:PROTEIN  Length:244
 aligned with VCP_VACCW | P68638 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:244
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259    
            VCP_VACCW    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 263
               SCOP domains d1ridb1 B:1-64 Complement control protein                       d1ridb2 B:65-126 Complement control protein                   d1ridb3 B:127-184 Complement control protein              d1ridb4 B:185-244 Complement control protein                 SCOP domains
               CATH domains 1ridB01 B:1-65 Complement Module, domain 1                       1ridB02 B:66-125 Complement Module, domain 1                -1ridB03 B:127-184 Complement Module, domain 1             1ridB04 B:185-234 Complement Module, domain 1     ---------- CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB01 B:187-242                                 -- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB02 B:187-242                                 -- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB03 B:187-242                                 -- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB04 B:187-242                                 -- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB05 B:187-242                                 -- Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB06 B:187-242                                 -- Pfam domains (6)
           Pfam domains (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB07 B:187-242                                 -- Pfam domains (7)
           Pfam domains (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Sushi-1ridB08 B:187-242                                 -- Pfam domains (8)
         Sec.struct. author .............................ee........ee.......eeee..eee....ee..................................ee........................ee.............ee..............ee.....eee................eee....................................eee.....eee...eee....eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: B:65-126 UniProt: 84-145                          SUSHI  PDB: B:127-184 UniProt: 146-203                    SUSHI  PDB: B:185-244 UniProt: 204-263                       PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rid B   1 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR 244
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Complement control module/SCR domain (70)

Superfamily: Complement control module/SCR domain (70)

Family: Complement control module/SCR domain (67)

Protein domain: Complement control protein (8)

Vaccinia virus [TaxId: 10245] (8)

1a	d1rida1	A:1-64
1b	d1rida2	A:65-126
1c	d1rida3	A:127-184
1d	d1rida4	A:185-244
1e	d1ridb1	B:1-64
1f	d1ridb2	B:65-126
1g	d1ridb3	B:127-184
1h	d1ridb4	B:185-244

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Ribbon (789)

Topology: Complement Module; domain 1 (62)

Homologous Superfamily: Complement Module, domain 1 (60)

Vaccinia virus wr. Organism_taxid: 10254. Strain: wr. (1)

1a	1ridA02	A:66-125
1b	1ridB02	B:66-125
1c	1ridA04	A:185-234
1d	1ridB04	B:185-234
1e	1ridA03	A:127-184
1f	1ridB03	B:127-184
1g	1ridA01	A:1-65
1h	1ridB01	B:1-65

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Sushi] (50)

Family: Sushi (50)

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) (5)

1a	Sushi-1ridB01	B:187-242
1b	Sushi-1ridB02	B:187-242
1c	Sushi-1ridB03	B:187-242
1d	Sushi-1ridB04	B:187-242
1e	Sushi-1ridB05	B:187-242
1f	Sushi-1ridB06	B:187-242
1g	Sushi-1ridB07	B:187-242
1h	Sushi-1ridB08	B:187-242

Asymmetric Unit(hide GO term definitions)

Chain A,B (VCP_VACCW | P68638)

molecular function
	GO:0001848	complement binding	Interacting selectively and non-covalently with any component or product of the complement cascade.
biological process
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0045916	negative regulation of complement activation	Any process that stops, prevents, or reduces the frequency, rate or extent of complement activation.
	GO:0039573	suppression by virus of host complement activation	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of complement activation. The activation of complement involves the sequential proteolysis of proteins to generate enzymes with catalytic activities. The biological functions of the complement include opsonization, inflammation, lysis of immune complexes, or enhancement of the humoral immune response. For example, the virus complement control protein (VCP) of vaccinia virus, and the complement control protein of herpesvirus inhibit C3 convertase.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Chain A,B (VCP_VACCC | P68639)

molecular function
	GO:0001848	complement binding	Interacting selectively and non-covalently with any component or product of the complement cascade.
biological process
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0045916	negative regulation of complement activation	Any process that stops, prevents, or reduces the frequency, rate or extent of complement activation.
	GO:0039573	suppression by virus of host complement activation	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of complement activation. The activation of complement involves the sequential proteolysis of proteins to generate enzymes with catalytic activities. The biological functions of the complement include opsonization, inflammation, lysis of immune complexes, or enhancement of the humoral immune response. For example, the virus complement control protein (VCP) of vaccinia virus, and the complement control protein of herpesvirus inhibit C3 convertase.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		IDS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SGN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Lys A:236 - Pro A:237	[ RasMol ]
		Lys B:236 - Pro B:237	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1rid
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	VCP_VACCC \| P68639
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	VCP_VACCW \| P68638
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	VCP_VACCC \| P68639
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	VCP_VACCW \| P68638
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	VCP_VACCC \| P68639	:	1e5g
	VCP_VACCW \| P68638	:	1g40 1g44 1vvc 1vvd 1vve 1y8e

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 16)

Sites (16, 16)

SS Bonds (16, 16)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 8)

Pfam Domains (1, 8)

Gene Ontology (12, 24)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File