1G44 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A COMPLEMENT CONTROL PROTEIN THAT REGULATES BOTH PATHWAYS OF COMPLEMENT ACTIVATION AND BINDS HEPARAN SULFATE PROTEOGLYCANS

Authors :   K. H. M. Murthy, S. A. Smith, V. K. Ganesh, K. W. Judge, N. Mullin, P. N. Barlow, C. M. Ogata, G. J. Kotwal

Date :   26 Oct 00 (Deposition) - 07 Feb 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)

Keywords :   Beta, Module, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. H. Murthy, S. A. Smith, V. K. Ganesh, K. W. Judge, N. Mullin, P. N. Barlow, C. M. Ogata, G. J. Kotwal
Crystal Structure Of A Complement Control Protein That Regulates Both Pathways Of Complement Activation And Binds Heparan Sulfate Proteoglycans.
Cell(Cambridge, Mass. ) V. 104 301 2001
PubMed-ID: 11207370 | Reference-DOI: 10.1016/S0092-8674(01)00214-8
(for further references see the PDB file header)

Molecule 1 - COMPLEMENT CONTROL PROTEIN
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Taxid	:	4922
	Organism Scientific	:	VACCINIA VIRUS
	Organism Taxid	:	10245

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1G44)

(no "Site" information available for 1G44)

Asymmetric Unit

No.	Residues
1	A:2	-	A:51
2	A:35	-	A:62
3	A:67	-	A:107
4	A:93	-	A:124
5	A:129	-	A:171
6	A:157	-	A:182
7	A:187	-	A:229
8	A:215	-	A:242
9	B:2	-	B:51
10	B:35	-	B:62
11	B:67	-	B:107
12	B:93	-	B:124
13	B:129	-	B:171
14	B:157	-	B:182
15	B:187	-	B:229
16	B:215	-	B:242
17	C:2	-	C:51
18	C:35	-	C:62
19	C:67	-	C:107
20	C:93	-	C:124
21	C:129	-	C:171
22	C:157	-	C:182
23	C:187	-	C:229
24	C:215	-	C:242

Asymmetric Unit

No.	Residues
1	Lys A:236	-	Pro A:237
2	Lys B:236	-	Pro B:237
3	Lys C:236	-	Pro C:237

(no "SAP(SNP)/Variant" information available for 1G44)

Asymmetric Unit (1, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	9	- A:65-125 B:65-125 C:65-125 A:127-184 B:127-184 C:127-183 A:185-243 B:185-243 C:185-243

Biological Unit 1 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	3	- A:65-125 - - A:127-184 - - A:185-243 - -

Biological Unit 2 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	3	- - B:65-125 - - B:127-184 - - B:185-243 -

Biological Unit 3 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	VCP_VACCW	19-83 84-145 146-203 204-263	3	- - - C:65-125 - - C:127-183 - - C:185-243

(no "Exon" information available for 1G44)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:223
 aligned with VCP_VACCW | P68638 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:243
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259   
            VCP_VACCW    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCV 262
               SCOP domains d1g    44a1 A        :  1-64 Complement control prote in        d1g44a2 A: 65-125 Complement control protein                  d1g44a3 A:127-184 Complement control protein              d1g44a4 A:185-243 Complement con trol protein               SCOP domains
               CATH domains 1g4    4A01 A        :  1-65 Complement Module, domai n 1        1g44A02 A :66-125 Complement Module, domain 1                1g44A03 A:127-184 Complement Module, domain 1             1g44A04 A:185-243 Complement Mod ule, domain 1              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...----......--------.--.....ee........ee.......ee...-...-...ee...........-.ee............ee.....ee...........-............ee-...........eee..........eee.eee....eee....eee.........eee............ee...............ee..-..eee.....eee...eee....eee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: A:65-125 UniProt: 84-145                          SUSHI  PDB: A:127-184 UniProt: 146-203                    SUSHI  PDB: A:185-243 UniProt: 204-263                      PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g44 A   1 CCT----PINMKF--------N--YNIGDTIEYLCLPGYRKQKMGPIYAKCTG-GWT-FNQCIKRRCPSPRDID-GQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELG-TGSMVWNPEAPICE-VKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCK-GYKLSGSSSSTCSPGNTWKPELPKCV 243
                              |    |10  |      - |  |   30        40        50  | | | 60        70   | |  80        90       100       110 |     120    | |130       140       150       160       170       180       190       200       210     | 220       230       240   
                              3    8   13       22 25                          53 | | |             74 |                               110 |          125 |                                                                                      216 |                         
                                                                                 55 | |               76                                 112            127                                                                                        218                         
                                                                                   57 |                                                                                                                                                                                        
                                                                                     59

Chain B from PDB  Type:PROTEIN  Length:231
 aligned with VCP_VACCW | P68638 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:243
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259   
            VCP_VACCW    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCV 262
               SCOP domains d1g44b1 B:1-64 C omplement control protein                      d1g44b2 B: 65-125 Complement control protein                  d1g44b3 B:127-184 Complement control protein              d1g44b4 B:185-243  Complement  c o  nt rol protein          SCOP domains
               CATH domains 1g44B01 B:1-65 C omplement Module, domain 1                      1g44B02 B :66-125 Complement Module, domain 1                1g44B03 B:127-184 Complement Module, domain 1             1g44B04 B:185-232  Complement  M o  du le, domai----------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................-............ee........ee.......ee...-...-...ee...........-.ee............ee.....ee...........-............ee-...........eee..........eee.eee....eee....eee.........eee..................-...........-..-.--..-....eee...eee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: B:65-125 UniProt: 84-145                          SUSHI  PDB: B:127-184 UniProt: 146-203                    SUSHI  PDB: B:185-243 UniProt: 204-263                      PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g44 B   1 CCTIPSRPINMKFKNS-ETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTG-GWT-FNQCIKRRCPSPRDID-GQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELG-TGSMVWNPEAPICE-VKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGF-RSYSYNDNVDF-CK-G--LS-SSSSTCSPGNTWKPELPKCV 243
                                    10     | |20        30        40        50  | | | 60        70   | |  80        90       100       110 |     120    | |130       140       150       160       170       180       190       200| |    210  | || | -|| |   230       240   
                                          16 |                                 53 | | |             74 |                               110 |          125 |                                                                       201 |       213 || |  || |                   
                                            18                                   55 | |               76                                 112            127                                                                         203         215| |  || |                   
                                                                                   57 |                                                                                                                                                          216 |  || |                   
                                                                                     59                                                                                                                                                            218  || |                   
                                                                                                                                                                                                                                                      221| |                   
                                                                                                                                                                                                                                                       222 |                   
                                                                                                                                                                                                                                                         224

Chain C from PDB  Type:PROTEIN  Length:228
 aligned with VCP_VACCW | P68638 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:243
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259   
            VCP_VACCW    20 CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCV 262
               SCOP domains d1g44c1 C:1-64 C omplement control protein                      d1g44c2  C :65-125 Complement control protein                 d1g44c3 C:127-183 Complement con  t rol protein           d 1g44c4 C:185-24 3 Complement c ontrol protein             SCOP domains
               CATH domains 1g44C01 C:1-65 C omplement Module, domain 1                      1g44C02   C:66-125 Complement Module, domain  1              1g44C03 C:127-185 Complement Mod  u le, domain 1            1g44C04 C:187-2 30                          ------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................-............ee........ee.......ee..--...-...ee.........-.-.ee............ee.....ee...........-............ee-...........eee..........eee.eee.--.-......eee............-.-.........ee....-..........ee..-..eee.....eee...eee....eee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SUSHI  PDB: - UniProt: 19-83                                    SUSHI  PDB: C:65-125 UniProt: 84-145                          SUSHI  PDB: C:127-183 UniProt: 146-203                    SUSHI  PDB: C:185-243 UniProt: 204-263                      PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g44 C   1 CCTIPSRPINMKFKNS-ETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCT--GWT-FNQCIKRRCPSPRD-D-GQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELG-TGSMVWNPEAPICE-VKCQSPPSISNGRHNGYEDFYTDGSVVTYSCN--Y-LIGNSGVLCSGGEWSDPPTCQ-V-CPHPTISNGYLSSGF-RSYSYNDNVDFKCK-GYKLSGSSSSTCSPGNTWKPELPKCV 243
                                    10     | |20        30        40        50 |  | | 60        70 | | |  80        90       100       110 |     120    | |130       140       150       | -| |    170       180  | | |190       200| |    210     | 220       230       240   
                                          16 |                                52 55 | |           72 | |                               110 |          125 |                            158  | |                 183 | |           201 |          216 |                         
                                            18                                     57 |             74 |                                 112            127                               161 |                   185 |             203            218                         
                                                                                     59               76                                                                                    163                     187

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Complement control module/SCR domain (70)

Superfamily: Complement control module/SCR domain (70)

Family: Complement control module/SCR domain (67)

Protein domain: Complement control protein (8)

Vaccinia virus [TaxId: 10245] (8)

1a	d1g44a1	A:1-64
1b	d1g44a2	A:65-125
1c	d1g44a3	A:127-184
1d	d1g44a4	A:185-243
1e	d1g44b1	B:1-64
1f	d1g44b2	B:65-125
1g	d1g44b3	B:127-184
1h	d1g44b4	B:185-243
1i	d1g44c1	C:1-64
1j	d1g44c2	C:65-125
1k	d1g44c3	C:127-183
1l	d1g44c4	C:185-243

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Ribbon (789)

Topology: Complement Module; domain 1 (62)

Homologous Superfamily: Complement Module, domain 1 (60)

Vaccinia virus. Organism_taxid: 10245. (2)

1a	1g44A02	A:66-125
1b	1g44A03	A:127-184
1c	1g44B03	B:127-184
1d	1g44C03	C:127-185
1e	1g44C01	C:1-65
1f	1g44B01	B:1-65
1g	1g44A01	A:1-65
1h	1g44C04	C:187-230
1i	1g44B02	B:66-125
1j	1g44C02	C:66-125
1k	1g44A04	A:185-243
1l	1g44B04	B:185-232

(no "Pfam Domain" information available for 1G44)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (VCP_VACCW | P68638)

molecular function
	GO:0001848	complement binding	Interacting selectively and non-covalently with any component or product of the complement cascade.
biological process
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0045916	negative regulation of complement activation	Any process that stops, prevents, or reduces the frequency, rate or extent of complement activation.
	GO:0039573	suppression by virus of host complement activation	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of complement activation. The activation of complement involves the sequential proteolysis of proteins to generate enzymes with catalytic activities. The biological functions of the complement include opsonization, inflammation, lysis of immune complexes, or enhancement of the humoral immune response. For example, the virus complement control protein (VCP) of vaccinia virus, and the complement control protein of herpesvirus inhibit C3 convertase.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1g44)

	Sites
(no "Sites" information available for 1g44)

	Cis Peptide Bonds
		Lys A:236 - Pro A:237	[ RasMol ]
		Lys B:236 - Pro B:237	[ RasMol ]
		Lys C:236 - Pro C:237	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1g44
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	VCP_VACCW \| P68638
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	VCP_VACCW \| P68638
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	VCP_VACCW \| P68638	:	1g40 1rid 1vvc 1vvd 1vve 1y8e

(no "Related Entries Specified in the PDB File" available for 1G44)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (24, 24)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 9)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 12)

CATH Domains (1, 12)

Pfam Domains (0, 0)

Gene Ontology (12, 12)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File