1R6T - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN TRYPTOPHANYL-TRNA SYNTHETASE

Authors :   X. -L. Yang, F. J. Otero, R. J. Skene, D. E. Mcree, L. Ribas De Pouplana, P. Schimmel

Date :   16 Oct 03 (Deposition) - 06 Jan 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A,B

Keywords :   Class Ic Trna Synthetase, Rossmann Fold Catalytical Domain, Anticodon Recognition Domain, Bound Trp-Amp, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. -L. Yang, F. J. Otero, R. J. Skene, D. E. Mcree, P. Schimmel, L. Ribas De Pouplana
Crystal Structures That Suggest Late Development Of Genetic Code Components For Differentiating Aromatic Side Chains
Proc. Natl. Acad. Sci. Usa V. 100 15376 2003
PubMed-ID: 14671330 | Reference-DOI: 10.1073/PNAS.2136794100

Molecule 1 - TRYPTOPHANYL-TRNA SYNTHETASE
	Chains	:	A, B
	EC Number	:	6.1.1.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET20B+
	Expression System Strain	:	B834(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	WARS
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TRYPTOPHAN--TRNA LIGASE, TRPRS, IFP53, HWRS

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 24)

No.	Name	Count	Type	Full Name
1	GOL	2	Ligand/Ion	GLYCEROL
2	MSE	21	Mod. Amino Acid	SELENOMETHIONINE
3	TYM	1	Ligand/Ion	TRYPTOPHANYL-5'AMP

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:159 , THR A:160 , GLY A:161 , ARG A:162 , GLY A:163 , GLY A:172 , HIS A:173 , PRO A:176 , GLN A:194 , GLU A:199 , GLN A:284 , ALA A:310 , ASP A:312 , GLN A:313 , PHE A:317 , PHE A:339 , PHE A:340 , LYS A:349 , MSE A:350 , HOH A:1002 , HOH A:1007 , HOH A:1018 , HOH A:1028 , HOH A:1044 , HOH A:1113	BINDING SITE FOR RESIDUE TYM A 501
2	AC2	SOFTWARE	LYS A:253 , ARG A:326 , ILE A:327 , TYR B:201 , THR B:207 , LEU B:208 , HOH B:1138 , HOH B:1213 , HOH B:1285	BINDING SITE FOR RESIDUE GOL B 601
3	AC3	SOFTWARE	ASP A:101 , LYS A:111 , GLY A:135 , PHE A:138	BINDING SITE FOR RESIDUE GOL A 602

(no "SS Bond" information available for 1R6T)

(no "Cis Peptide Bond" information available for 1R6T)

Asymmetric/Biological Unit (2, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052406	A	54	S	SYWC_HUMAN	Polymorphism	2234521	A	A	54	S
2	UniProt	VAR_036466	E	455	D	SYWC_HUMAN	Unclassified	---	A/B	E	455	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (3, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	WHEP_TRS_2	PS51185	WHEP-TRS domain profile.	SYWC_HUMAN	8-64	1	A:8-60
2	WHEP_TRS_1	PS00762	WHEP-TRS domain signature.	SYWC_HUMAN	19-47	1	A:19-47
3	AA_TRNA_LIGASE_I	PS00178	Aminoacyl-transfer RNA synthetases class-I signature.	SYWC_HUMAN	164-174	2	A:164-174 B:164-174

Asymmetric/Biological Unit (10, 19)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000392882	2a	ENSE00001513471	chr14:100841927-100841620	308	SYWC_HUMAN	-	0	0	-	-
1.3	ENST00000392882	3	ENSE00002192528	chr14:100835595-100835424	172	SYWC_HUMAN	1-33	33	1	A:7-33 -	27 -
1.4	ENST00000392882	4	ENSE00001607458	chr14:100828258-100828045	214	SYWC_HUMAN	34-105	72	2	A:34-105 (gaps) B:97-105	72 9
1.5	ENST00000392882	5	ENSE00000941372	chr14:100826999-100826891	109	SYWC_HUMAN	105-141	37	2	A:105-141 B:105-141	37 37
1.6	ENST00000392882	6	ENSE00000941373	chr14:100820903-100820784	120	SYWC_HUMAN	141-181	41	2	A:141-181 B:141-181	41 41
1.7	ENST00000392882	7	ENSE00000941374	chr14:100820206-100820024	183	SYWC_HUMAN	181-242	62	2	A:181-242 B:181-242	62 62
1.8	ENST00000392882	8	ENSE00000941375	chr14:100813183-100813083	101	SYWC_HUMAN	242-276	35	2	A:242-276 B:242-276	35 35
1.9	ENST00000392882	9	ENSE00000941376	chr14:100809724-100809612	113	SYWC_HUMAN	276-313	38	2	A:276-313 B:276-313	38 38
1.10	ENST00000392882	10	ENSE00000941377	chr14:100808908-100808735	174	SYWC_HUMAN	314-371	58	2	A:314-371 B:314-371 (gaps)	58 58
1.11	ENST00000392882	11	ENSE00000941378	chr14:100803539-100803399	141	SYWC_HUMAN	372-418	47	2	A:372-418 B:372-418	47 47
1.12b	ENST00000392882	12b	ENSE00001314927	chr14:100801373-100800125	1249	SYWC_HUMAN	419-471	53	2	A:419-467 B:419-467	49 49

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:440
 aligned with SYWC_HUMAN | P23381 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:461
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466 
           SYWC_HUMAN     7 ASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLS 467
               SCOP domains d1r6ta1 A:7-60                                        ---------------------d1r6ta2 A:82-467 Tryptophanyl-tRNA synthetase (TrpRS)                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1r6tA01 A:7-60  [code=1.10.287.10, no name defined]   ---------------------1r6tA02 A:82-353 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                          1r6tA03 A:354-467 Tyrosyl-Transfer RNA Synthetase                                                                  CATH domains
               Pfam domains -----WHEP-TRS-1r6tA01 A:12-60                         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......---------------------..ee....ee.......hhhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhhh...eeeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhhh....eeeee...ee..eeeee..............hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------S----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------------ SAPs(SNPs)
                PROSITE (1) -WHEP_TRS_2  PDB: A:8-60 UniProt: 8-64                    ---------------------------------------------------------------------------------------------------AA_TRNA_LIG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------WHEP_TRS_1  PDB: A:19-47     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.3  PDB: A:7-33      Exon 1.4  PDB: A:34-105 (gaps) UniProt: 34-105                          -----------------------------------Exon 1.6  PDB: A:141-181 UniProt: 141-181------------------------------------------------------------Exon 1.8  PDB: A:242-276           -------------------------------------Exon 1.10  PDB: A:314-371 UniProt: 314-371                Exon 1.11  PDB: A:372-418 UniProt: 372-418     Exon 1.12b  PDB: A:419-467 UniProt: 419-471       Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------Exon 1.5  PDB: A:105-141             ---------------------------------------Exon 1.7  PDB: A:181-242 UniProt: 181-242                     ---------------------------------Exon 1.9  PDB: A:276-313              ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1r6t A   7 ASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKmLVSLKmSYKAAAGEDYKA---------------------EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDmNQVLDAYENKKPFYLYTGRGPSSEAmHVGHLIPFIFTKWLQDVFNVPLVIQmTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYmGmSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRmTRDVAPRIGYPKPALLHSTFFPALQGAQTKmSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFmYLTFFLEDDDKLEQIRKDYTSGAmLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFmTPRKLA 467
                                    16        26        36     |  46 |      56   |     -         -     |  86        96       106       116       126       136      |146       156       166  |    176       186       196       206       216       226       236    | |246       256       266       276       286       296       306       316  |    326       336       346   |   356       366       376       386       396    |  406       416       426       436       446       456    |  466 
                                                              42-MSE |          60                    82                                                          143-MSE                   169-MSE                   195-MSE                                       241-MSE                                                                       319-MSE                        350-MSE                                            401-MSE                 425-MSE                             461-MSE  
                                                                    48-MSE                                                                                                                                                                                            243-MSE

Chain B from PDB  Type:PROTEIN  Length:362
 aligned with SYWC_HUMAN | P23381 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:371
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466 
           SYWC_HUMAN    97 GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLS 467
               SCOP domains d1r6tb_ B: Tryptophanyl-tRNA synthetase (TrpRS)                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1r6tB01 B:97-345 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                   ---------1r6tB02 B:355-467 Tyrosyl-Transfer RNA Synthetase                                                                 CATH domains
           Pfam domains (1) ------------------------------------------------------tRNA-synt_1b-1r6tB01 B:151-443                                                                                                                                                                                                                                                                       ------------------------ Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------tRNA-synt_1b-1r6tB02 B:151-443                                                                                                                                                                                                                                                                       ------------------------ Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhhh....eeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee..hhhhhhhhhhhhhhh.....eeeee........---------.........hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------------ SAPs(SNPs)
                PROSITE (1) -------------------------------------------------------------------AA_TRNA_LIG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4 -----------------------------------Exon 1.6  PDB: B:141-181 UniProt: 141-181------------------------------------------------------------Exon 1.8  PDB: B:242-276           -------------------------------------Exon 1.10  PDB: B:314-371 (gaps) UniProt: 314-371         Exon 1.11  PDB: B:372-418 UniProt: 372-418     Exon 1.12b  PDB: B:419-467 UniProt: 419-471       Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.5  PDB: B:105-141             ---------------------------------------Exon 1.7  PDB: B:181-242 UniProt: 181-242                     ---------------------------------Exon 1.9  PDB: B:276-313              ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1r6t B  97 GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDmNQVLDAYENKKPFYLYTGRGPSSEAmHVGHLIPFIFTKWLQDVFNVPLVIQmTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYmGmSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRmTRDVAPRIGYPKPALLHSTFFPALQG---------PNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFmYLTFFLEDDDKLEQIRKDYTSGAmLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFmTPRKLA 467
                                   106       116       126       136      |146       156       166  |    176       186       196       206       216       226       236    | |246       256       266       276       286       296       306       316  |    326       336        |-       356       366       376       386       396    |  406       416       426       436       446       456    |  466 
                                                                        143-MSE                   169-MSE                   195-MSE                                       241-MSE                                                                       319-MSE                   345       355                                           401-MSE                 425-MSE                             461-MSE  
                                                                                                                                                                            243-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1 (328)

Human (Homo sapiens) (27)

1a	1r6tB01	B:97-345
1b	1r6tA02	A:82-353

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Helix Hairpins (718)

Homologous Superfamily: [code=1.10.287.10, no name defined] (116)

Human (Homo sapiens) (2)

1r6tA01

A:7-60

Topology: Tyrosyl-Transfer RNA Synthetase (70)

Homologous Superfamily: Tyrosyl-Transfer RNA Synthetase (70)

Human (Homo sapiens) (11)

3a	1r6tB02	B:355-467
3b	1r6tA03	A:354-467

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: HUP (230)

Family: tRNA-synt_1b (51)

Homo sapiens (Human) (10)

1a	tRNA-synt_1b-1r6tB01	B:151-443
1b	tRNA-synt_1b-1r6tB02	B:151-443

Clan: no clan defined [family: WHEP-TRS] (3)

Family: WHEP-TRS (3)

Homo sapiens (Human) (2)

WHEP-TRS-1r6tA01

A:12-60

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (SYWC_HUMAN | P23381)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004812	aminoacyl-tRNA ligase activity	Catalysis of the formation of aminoacyl-tRNA from ATP, amino acid, and tRNA with the release of diphosphate and AMP.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004830	tryptophan-tRNA ligase activity	Catalysis of the reaction: ATP + L-tryptophan + tRNA(Trp) = AMP + diphosphate + L-tryptophanyl-tRNA(Trp).
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0045765	regulation of angiogenesis	Any process that modulates the frequency, rate or extent of angiogenesis.
	GO:0006418	tRNA aminoacylation for protein translation	The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA, to be used in ribosome-mediated polypeptide synthesis.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006436	tryptophanyl-tRNA aminoacylation	The process of coupling tryptophan to tryptophanyl-tRNA, catalyzed by tryptophanyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TYM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1r6t)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1r6t
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SYWC_HUMAN \| P23381
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.1.1.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SYWC_HUMAN \| P23381
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SYWC_HUMAN \| P23381	:	1o5t 1r6u 1ulh 2ake 2azx 2dr2 2quh 2qui 2quj 2quk

(no "Related Entries Specified in the PDB File" available for 1R6T)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 24)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 3)

PROSITE Motifs (3, 4)

Exons (10, 19)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 3)

CATH Domains (3, 5)

Pfam Domains (2, 3)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File