Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF THE CAF1M:CAF1 CHAPERONE:SUBUNIT PREASSEMBLY COMPLEX
 
Authors :  A. V. Zavialov, J. Berglund, A. F. Pudney, L. J. Fooks, T. M. Ibrahim, S. Macintyre, S. D. Knight
Date :  28 Apr 03  (Deposition) - 24 Jun 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Chaperone, Chaperone-Target Complex, Chaperone-Subunit Complex, Protein Fiber, Donor Strand Complementation, Donor Strand Exchange, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. V. Zavialov, J. Berglund, A. F. Pudney, L. J. Fooks, T. M. Ibrahim, S. Macintyre, S. D. Knight
Structure And Biogenesis Of The Capsular F1 Antigen From Yersinia Pestis. Preserved Folding Energy Drives Fiber Formation
Cell(Cambridge, Mass. ) V. 113 587 2003
PubMed-ID: 12787500  |  Reference-DOI: 10.1016/S0092-8674(03)00351-9
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHAPERONE PROTEIN CAF1M
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPFM-1-6H
    Expression System Taxid562
    Expression System VariantB834 (DE3)
    Expression System Vector TypePLASMID
    FragmentRESIDUES 24-258 OF SWS P26926
    GeneCAF1M
    Organism ScientificYERSINIA PESTIS
    Organism Taxid632
    StrainKIM5
    SynonymCAF1M CHAPERONE
 
Molecule 2 - F1 CAPSULE ANTIGEN
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPFM-1-6H
    Expression System Taxid562
    Expression System VariantB834 (DE3)
    Expression System Vector TypePLASMID
    FragmentRESIDUES 35-170 OF SWS P26948
    GeneCAF1
    Organism ScientificYERSINIA PESTIS
    Organism Taxid632
    Other DetailsHIS-TAGGED FRAGMENT OF F1 CAPSULE
    StrainKIM5

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1P5V)

(-) Sites  (0, 0)

(no "Site" information available for 1P5V)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:98 -A:137

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr A:64 -Pro A:65

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1P5V)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PILI_CHAPERONEPS00635 Gram-negative pili assembly chaperone signature.CAF1M_YERPE110-127  1A:87-103

(-) Exons   (0, 0)

(no "Exon" information available for 1P5V)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:191
 aligned with CAF1M_YERPE | P26926 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:227
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       
          CAF1M_YERPE    30 FASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDEDIWVDDATNKQKFNPDKDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKGLAGARNVSWRIINDQGGLDRLYSKNV 256
               SCOP domains d1p5va1 A:7-147 Chaperone protein Caf1m                                                                                                      d1p5va2 A:148-233 Caf1m                                                                SCOP domains
               CATH domains -------1p5vA01 A:14-145 PapD-like                                                                                                          ---1p5vA02 A:149-230  [code=2.60.40.1070, no name defined]                           --- CATH domains
               Pfam domains ------Pili_assembly_N-1p5vA01 A:13-148                                                                                                        ------------------Pili_assembly_C-1p5vA02 A:167-230                               --- Pfam domains
         Sec.struct. author ..eeeeeeee...eeeee.....eeeeeee.....eeeeeeee---------........eeee....eeeeeeee..........eeeeeeeeee.--------------------.eeeeeeeeeeeeeeeeeee......hhhhhhhhh.......eeeeee.....eeeeeeee........ee...eeeeee..-------.eeeee..........eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------PILI_CHAPERONE    --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1p5v A   7 FASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIY---------DPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIP--------------------KDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLP-------NVSWRIINDQGGLDRLYSKNV 233
                                    16        26        36        46  |      -  |     66        76        86        96      |  -         -       126       136       146       156       166       176       186       196        |-      |216       226       
                                                                     49        59                                         103                  124                                                                              205     213                    

Chain B from PDB  Type:PROTEIN  Length:136
 aligned with CAF1_YERPE | P26948 from UniProtKB/Swiss-Prot  Length:170

    Alignment length:136
                                    44        54        64        74        84        94       104       114       124       134       144       154       164      
           CAF1_YERPE    35 VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ 170
               SCOP domains d1p5vb_ B: F1 capsule antigen Caf1                                                                                                       SCOP domains
               CATH domains 1p5vB00 B:14-149  [code=2.60.40.1310, no name defined]                                                                                   CATH domains
               Pfam domains Antig_Caf1-1p5vB01 B:14-149                                                                                                              Pfam domains
         Sec.struct. author ...eeeeeeeee...ee...........eeeeeeee......hhh.eeee........eeeee......eeeeeeeee.....ee..ee...............eeeeeeeeee........eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1p5v B  14 VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ 149
                                    23        33        43        53        63        73        83        93       103       113       123       133       143      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Clan: E-set (290)

(-) Gene Ontology  (8, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CAF1M_YERPE | P26926)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0061077    chaperone-mediated protein folding    The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone.
    GO:0043711    pilus organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a pilus, a short filamentous structure on a bacterial cell, flagella-like in structure and generally present in many copies.
cellular component
    GO:0030288    outer membrane-bounded periplasmic space    The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain B   (CAF1_YERPE | P26948)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
cellular component
    GO:0042603    capsule    A protective structure surrounding some fungi and bacteria, attached externally to the cell wall and composed primarily of polysaccharides. Capsules are highly organized structures that adhere strongly to cells and cannot be easily removed. Capsules play important roles in pathogenicity, preventing phagocytosis by other cells, adherance, and resistance to dessication.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1p5v)
 
  Sites
(no "Sites" information available for 1p5v)
 
  Cis Peptide Bonds
    Thr A:64 - Pro A:65   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1p5v
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAF1M_YERPE | P26926
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CAF1_YERPE | P26948
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CAF1M_YERPE | P26926
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CAF1_YERPE | P26948
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAF1M_YERPE | P269261p5u 1z9s 2os7 3dos 3dpb 3dsn 4ay0 4ayf 4az8 4b0m
        CAF1_YERPE | P269481p5u 1z9s 3dos 3dpb 3dsn 4ayf 4az8 4b0m

(-) Related Entries Specified in the PDB File

1p5u X-RAY STRUCTURE OF THE TERNARY CAF1M:CAF1:CAF1 CHAPERONE: SUBUNIT:SUBUNIT COMPLEX