Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROLYL-TRNA SYNTHETASE FROM METHANOCALDOCOCCUS JANASCHII
 
Authors :  S. Kamtekar, W. D. Kennedy, J. Wang, C. Stathopoulos, D. Soll, T. A. Steitz
Date :  30 Dec 02  (Deposition) - 04 Mar 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Class-Ii Trna Synthetase, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Kamtekar, W. D. Kennedy, J. Wang, C. Stathopoulos, D. Soll, T. A. Steitz
The Structural Basis Of Cysteine Aminoacylation Of Trnapro By Prolyl-Trna Synthetases
Proc. Natl. Acad. Sci. Usa V. 100 1673 2003
PubMed-ID: 12578991  |  Reference-DOI: 10.1073/PNAS.0437911100
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROLINE-TRNA SYNTHETASE
    ChainsA, B, C, D
    EC Number6.1.1.15
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21DE3 RECA-
    Expression System Taxid562
    FragmentN TERMINALLY HIS TAGGED AND THROMBIN DIGESTED ENZYME
    GeneMJ1238
    Organism ScientificMETHANOCALDOCOCCUS JANNASCHII
    Organism Taxid2190
    Other DetailsSTRAIN SUPPLEMENTED WITH ADDITIONAL PLASMID ENCODING RARE TRNAS
    SynonymPROLYL-TRNA SYNTHETASE;
PROLINE--TRNA LIGASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NJ8)

(-) Sites  (0, 0)

(no "Site" information available for 1NJ8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NJ8)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:120 -Pro A:121
2Leu B:120 -Pro B:121
3Leu C:120 -Pro C:121
4Leu D:120 -Pro D:121

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NJ8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NJ8)

(-) Exons   (0, 0)

(no "Exon" information available for 1NJ8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:456
 aligned with SYP_METJA | Q58635 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:456
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      
            SYP_METJA     - -MEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
               SCOP domains d1nj8a3 A:0-267 Prolyl-tRNA synthetase (ProRS)                                                                                                                                                                                                                              d1nj8a1 A:268-393 Prolyl-tRNA synthetase (ProRS) domain                                                                       d1nj8a2 A:394-455 C-terminal domain of ProRS                   SCOP domains
               CATH domains 1nj8A01 A:0-273 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                               1nj8A02 A:274-376  [code=3.40.50.800, no name defined]                                                 -----------------1nj8A03 A:394-454  [code=3.30.110.30, no name defined]       - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhh..ee.....eeehhhhhhhh..hhhhhhh.eeeee....eeeeeeee...hhhhhhhhhhh...........eeeee.....................eeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhh...eeeee..........eeeeeeee.....eeeeeeeeeeehhhhhhh..eee.....eee.eeeeeee.hhhhhhhhhhhh...............eeeee.....hhhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh...eeeeehhhhhhh.eeeeee.....eeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhheee....hhhhhhhhh.....eeeee.hhhhhhhhhhhhhh..eeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nj8 A   0 MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      

Chain B from PDB  Type:PROTEIN  Length:456
 aligned with SYP_METJA | Q58635 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:456
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      
            SYP_METJA     - -MEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
               SCOP domains d1nj8b3 B:0-267 Prolyl-tRNA synthetase (ProRS)                                                                                                                                                                                                                              d1nj8b1 B:268-393 Prolyl-tRNA synthetase (ProRS) domain                                                                       d1nj8b2 B:394-455 C-terminal domain of ProRS                   SCOP domains
               CATH domains 1nj8B01 B:0-273 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                               1nj8B02 B:274-376  [code=3.40.50.800, no name defined]                                                 -----------------1nj8B03 B:394-454  [code=3.30.110.30, no name defined]       - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh..ee.........eehhhhhhhhhhhhhhhhhhhhh..eee.....eeehhhhhhh......hhhhh.eeeee..ee....eee...hhhhhhhhhhhhh.hhhhh.eeeeeeeeee..............eeeeeeeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....ee.............eeeeeeee.....eeeeeeeee..hhhhhhh..eee.....eee.ee..eee.hhhhhhhhhhhh...............eeee.......hhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh...eeee.hhhhhhh.eeeeee.......eee..hhhhhhhhhhhhhhhhhhhhhhhhhhh.eee....hhhhhhhhhh....eee...hhhhhhhhhhhhhh..eeeee......eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nj8 B   0 MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      

Chain C from PDB  Type:PROTEIN  Length:456
 aligned with SYP_METJA | Q58635 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:456
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      
            SYP_METJA     - -MEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
               SCOP domains d1nj8c3 C:0-267 Prolyl-tRNA synthetase (ProRS)                                                                                                                                                                                                                              d1nj8c1 C:268-393 Prolyl-tRNA synthetase (ProRS) domain                                                                       d1nj8c2 C:394-455 C-terminal domain of ProRS                   SCOP domains
               CATH domains 1nj8C01 C:0-273 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                               1nj8C02 C:274-376  [code=3.40.50.800, no name defined]                                                 -----------------1nj8C03 C:394-454  [code=3.30.110.30, no name defined]       - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhh..ee.....eeehhhhhhhh..hhhhhhh.eeeee....eeeeeeee...hhhhhhhhhhh...........eeeee.....................eeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhh...eeeee..........eeeeeeee.....eeeeeeeeeeehhhhhhh..eee.....eee.eeeeeee.hhhhhhhhhhhh...............eeeee.....hhhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh...eeeeehhhhhhh.eeeeee.....eeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhheee....hhhhhhhhh.....eeeee.hhhhhhhhhhhhhh..eeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nj8 C   0 MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      

Chain D from PDB  Type:PROTEIN  Length:456
 aligned with SYP_METJA | Q58635 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:456
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      
            SYP_METJA     - -MEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
               SCOP domains d1nj8d3 D:0-267 Prolyl-tRNA synthetase (ProRS)                                                                                                                                                                                                                              d1nj8d1 D:268-393 Prolyl-tRNA synthetase (ProRS) domain                                                                       d1nj8d2 D:394-455 C-terminal domain of ProRS                   SCOP domains
               CATH domains 1nj8D01 D:0-273 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                               1nj8D02 D:274-376  [code=3.40.50.800, no name defined]                                                 -----------------1nj8D03 D:394-454  [code=3.30.110.30, no name defined]       - CATH domains
           Pfam domains (1) ------------------------------------tRNA-synt_2b-1nj8D09 D:36-209                                                                                                                                                 ----------------------------------------------------------------------HGTP_anticodon-1nj8D01 D:280-374                                                               -------------------ProRS-C_2-1nj8D05 D:394-455                                    Pfam domains (1)
           Pfam domains (2) ------------------------------------tRNA-synt_2b-1nj8D10 D:36-209                                                                                                                                                 ----------------------------------------------------------------------HGTP_anticodon-1nj8D02 D:280-374                                                               -------------------ProRS-C_2-1nj8D06 D:394-455                                    Pfam domains (2)
           Pfam domains (3) ------------------------------------tRNA-synt_2b-1nj8D11 D:36-209                                                                                                                                                 ----------------------------------------------------------------------HGTP_anticodon-1nj8D03 D:280-374                                                               -------------------ProRS-C_2-1nj8D07 D:394-455                                    Pfam domains (3)
           Pfam domains (4) ------------------------------------tRNA-synt_2b-1nj8D12 D:36-209                                                                                                                                                 ----------------------------------------------------------------------HGTP_anticodon-1nj8D04 D:280-374                                                               -------------------ProRS-C_2-1nj8D08 D:394-455                                    Pfam domains (4)
         Sec.struct. author ..hhhhhhhhhhhhh..ee.........eehhhhhhhhhhhhhhhhhhhhh..eee.....eeehhhhhhh......hhhhh.eeeee..ee....eee...hhhhhhhhhhhhh.hhhhh.eeeeeeeeee..............eeeeeeeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....ee.............eeeeeeee.....eeeeeeeee..hhhhhhh..eee.....eee.ee..eee.hhhhhhhhhhhh...............eeee.......hhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh...eeee.hhhhhhh.eeeeee.......eee..hhhhhhhhhhhhhhhhhhhhhhhhhhh.eee....hhhhhhhhhh....eee...hhhhhhhhhhhhhh..eeeee......eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nj8 D   0 MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY 455
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 12)

Asymmetric Unit

(-) CATH Domains  (3, 12)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 12)

Asymmetric Unit

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (SYP_METJA | Q58635)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0004812    aminoacyl-tRNA ligase activity    Catalysis of the formation of aminoacyl-tRNA from ATP, amino acid, and tRNA with the release of diphosphate and AMP.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0004827    proline-tRNA ligase activity    Catalysis of the reaction: ATP + L-proline + tRNA(Pro) = AMP + diphosphate + L-prolyl-tRNA(Pro).
biological process
    GO:0006433    prolyl-tRNA aminoacylation    The process of coupling proline to prolyl-tRNA, catalyzed by prolyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
    GO:0006418    tRNA aminoacylation for protein translation    The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA, to be used in ribosome-mediated polypeptide synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1nj8)
 
  Sites
(no "Sites" information available for 1nj8)
 
  Cis Peptide Bonds
    Leu A:120 - Pro A:121   [ RasMol ]  
    Leu B:120 - Pro B:121   [ RasMol ]  
    Leu C:120 - Pro C:121   [ RasMol ]  
    Leu D:120 - Pro D:121   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nj8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SYP_METJA | Q58635
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.1.1.15
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SYP_METJA | Q58635
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1NJ8)

(-) Related Entries Specified in the PDB File

1nj1 1nj2 1nj5 1nj6