Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF AN ISOLATED ANTIBODY VL DOMAIN
 
Authors :  K. L. Constantine, M. S. Friedrichs, W. J. Metzler, M. Wittekind, P. Hensley, L. Mueller
Date :  16 Sep 93  (Deposition) - 31 Jan 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
Keywords :  Immunoglobulin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. L. Constantine, M. S. Friedrichs, W. J. Metzler, M. Wittekind, P. Hensley, L. Mueller
Solution Structure Of An Isolated Antibody Vl Domain.
J. Mol. Biol. V. 236 310 1994
PubMed-ID: 8107112  |  Reference-DOI: 10.1006/JMBI.1994.1137
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - IGG2A-KAPPA 26-10 FV (LIGHT CHAIN)
    Chains: A
    Engineered: YES
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090

 Structural Features

(-) Chains, Units

  
NMR Structure (15x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MAJ)

(-) Sites  (3, 3)

NMR Structure (3, 3)
No.NameEvidenceResiduesDescription
1CD1UNKNOWNGLN A:27 , SER A:28 , LEU A:29 , VAL A:30 , HIS A:31 , SER A:32 , ASN A:33 , GLY A:34 , ASN A:35 , THR A:36 , TYR A:37 , LEU A:38 , ASN A:39NULL
2CD2UNKNOWNLYS A:55 , VAL A:56 , SER A:57 , ASN A:58 , ARG A:59 , PHE A:60 , SER A:61NULL
3CD3UNKNOWNSER A:94 , GLN A:95 , THR A:96 , THR A:97 , HIS A:98 , VAL A:99 , PRO A:100 , PRO A:101 , THR A:102NULL

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1A:23 -A:93

(-) Cis Peptide Bonds  (2, 30)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15Thr A:7 -Pro A:8
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15Val A:99 -Pro A:100

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MAJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1MAJ)

(-) Exons   (0, 0)

(no "Exon" information available for 1MAJ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:113
 aligned with KV2A7_MOUSE | P01631 from UniProtKB/Swiss-Prot  Length:113

    Alignment length:113
                                    10        20        30        40        50        60        70        80        90       100       110   
          KV2A7_MOUSE     1 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR 113
               SCOP domains d1maja_ A: Immunoglobulin light chain kappa variable domain, VL-kappa                                             SCOP domains
               CATH domains 1majA00 A:1-113 Immunoglobulins                                                                                   CATH domains
               Pfam domains V-set-1majA01 A:1-111                                                                                          -- Pfam domains
         Sec.struct. author ..eeeee.eeeee...eeeeeeeeee...........eeeeee......eeeeeee.........eeeeeee..eeeeeeeee.....eeeeee.......eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 1maj A   1 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR 113
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ig (577)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (KV2A7_MOUSE | P01631)
molecular function
    GO:0003823    antigen binding    Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1maj)
 
  Sites
    CD1  [ RasMol ]  +environment [ RasMol ]
    CD2  [ RasMol ]  +environment [ RasMol ]
    CD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:7 - Pro A:8   [ RasMol ]  
    Val A:99 - Pro A:100   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1maj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KV2A7_MOUSE | P01631
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KV2A7_MOUSE | P01631
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KV2A7_MOUSE | P01631: 1bfv 1cfv 1dlf 1mak 1n4x 1svz 1wz1 2bfv 2dlf 2hkf 2hkh 2ipt 2iqa 2o5x 2o5y 2o5z 2r0w 2vq1

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MAJ)