Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  INTERFACIAL ACTIVATION OF THE LIPASE-PROCOLIPASE COMPLEX BY MIXED MICELLES REVEALED BY X-RAY CRYSTALLOGRAPHY
 
Authors :  H. Van Tilbeurgh, M. -P. Egloff, C. Cambillau
Date :  19 Aug 94  (Deposition) - 01 Nov 94  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.04
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hydrolase(Carboxylic Esterase) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Van Tilbeurgh, M. P. Egloff, C. Martinez, N. Rugani, R. Verger, C. Cambillau
Interfacial Activation Of The Lipase-Procolipase Complex By Mixed Micelles Revealed By X-Ray Crystallography.
Nature V. 362 814 1993
PubMed-ID: 8479519  |  Reference-DOI: 10.1038/362814A0
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COLIPASE
    Chains: A
    Engineered: YES
    Organ: PANCREAS
    Organism Common: PIG
    Organism Scientific: SUS SCROFA
    Organism Taxid: 9823
 
Molecule 2 - LIPASE
    Chains: B
    EC Number: 3.1.1.3
    Engineered: YES
    Organ: PANCREAS
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1BNG1Ligand/IonB-NONYLGLUCOSIDE
2CA1Ligand/IonCALCIUM ION
3PLC1Ligand/IonDIUNDECYL PHOSPHATIDYL CHOLINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS B:80 , GLU B:83 , ASN B:84 , ARG B:111 , THR B:112 , GLY B:113 , TRP B:252 , PLC B:452BINDING SITE FOR RESIDUE BNG B 450
2AC2SOFTWAREGLU B:187 , ARG B:190 , ASP B:192 , ASP B:195BINDING SITE FOR RESIDUE CA B 451
3AC3SOFTWAREGLY B:76 , PHE B:77 , ILE B:78 , TYR B:114 , SER B:152 , LEU B:153 , ALA B:178 , LEU B:213 , PHE B:215 , TRP B:252 , ARG B:256 , HIS B:263 , BNG B:450BINDING SITE FOR RESIDUE PLC B 452
4CATUNKNOWNSER B:152 , ASP B:176 , HIS B:263NULL

(-) SS Bonds  (11, 11)

Asymmetric/Biological Unit
No.Residues
1A:17 -A:28
2A:23 -A:39
3A:27 -A:61
4A:49 -A:69
5A:63 -A:87
6B:4 -B:10
7B:90 -B:101
8B:237 -B:261
9B:285 -B:296
10B:299 -B:304
11B:433 -B:449

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Ser B:15 -Pro B:16
2Val B:210 -Pro B:211
3Phe B:297 -Pro B:298

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1LPA)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1COLIPASE_2PS51342 Colipase family profile.COL_PIG23-107  1A:6-90
2COLIPASE_1PS00121 Colipase signature.COL_PIG72-80  1A:55-63
3LIPASE_SERPS00120 Lipases, serine active site.LIPP_HUMAN163-172  1B:146-155
4PLATPS50095 PLAT domain profile.LIPP_HUMAN355-465  1B:338-449

(-) Exons   (11, 11)

Asymmetric/Biological Unit (11, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003692211ENSE00001449232chr10:118305443-11830547028LIPP_HUMAN-00--
1.2ENST000003692212ENSE00002173518chr10:118305605-11830565046LIPP_HUMAN1-16160--
1.3ENST000003692213ENSE00001193593chr10:118306806-118306960155LIPP_HUMAN16-67521B:1-5051
1.4ENST000003692214ENSE00000986714chr10:118307872-118307994123LIPP_HUMAN68-108411B:51-9141
1.5aENST000003692215aENSE00001097273chr10:118310610-118310744135LIPP_HUMAN109-153451B:92-13645
1.6ENST000003692216ENSE00001148734chr10:118313239-118313350112LIPP_HUMAN154-191381B:137-17438
1.7ENST000003692217ENSE00001097277chr10:118314690-118314809120LIPP_HUMAN191-231411B:174-21441
1.8ENST000003692218ENSE00001097284chr10:118314900-118315019120LIPP_HUMAN231-271411B:214-25441
1.9ENST000003692219ENSE00001097280chr10:118315512-118315630119LIPP_HUMAN271-310401B:254-29340
1.10ENST0000036922110ENSE00001097279chr10:118318666-118318795130LIPP_HUMAN311-354441B:294-33744
1.11ENST0000036922111ENSE00001097275chr10:118319928-118320036109LIPP_HUMAN354-390371B:337-37337
1.12ENST0000036922112ENSE00001097286chr10:118320984-118321148165LIPP_HUMAN390-445561B:373-429 (gaps)57
1.13ENST0000036922113ENSE00001097276chr10:118327247-118327367121LIPP_HUMAN445-465211B:429-44921

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:85
 aligned with COL_PIG | P02703 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:85
                                    32        42        52        62        72        82        92       102     
              COL_PIG    23 GIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDV 107
               SCOP domains d1lpaa1 A:6-44 (Pro)colipase           d1lpaa2 A:45-90 (Pro)colipase                  SCOP domains
               CATH domains 1lpaA00 A:6-90 Lipase, subunit A                                                      CATH domains
               Pfam domains Colipase-1lpaA01 A:6-43               -Colipase_C-1lpaA02 A:45-89                   - Pfam domains
         Sec.struct. author ...eeee..................hhhh..eeeee........eee...hhhhhh.....eeeeeeeehhhhhh...eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) COLIPASE_2  PDB: A:6-90 UniProt: 23-107                                               PROSITE (1)
                PROSITE (2) -------------------------------------------------COLIPASE_--------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 1lpa A   6 GIIINLDEGELCLNSAQCKSNCCQHDTILSLLRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHNV  90
                                    15        25        35        45        55        65        75        85     


Chain B from PDB  Type:PROTEIN  Length:449
 aligned with LIPP_HUMAN | P16233 from UniProtKB/Swiss-Prot  Length:465

    Alignment length:449
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456         
           LIPP_HUMAN    17 KEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC 465
               SCOP domains d1lpab2 B:1-336 Pancreatic lipase, N-terminal domain                                                                                                                                                                                                                                                                                             d1lpab1 B:337-449 Pancreatic lipase, C-terminal domain                                                           SCOP domains
               CATH domains 1lpaB01 B:1-337  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                                                                                             1lpaB02 B:338-448 Lipoxygenase-1                                                                              - CATH domains
               Pfam domains Lipase-1lpaB01 B:1-335                                                                                                                                                                                                                                                                                                                          ----PLAT-1lpaB02 B:340-446                                                                                    --- Pfam domains
         Sec.struct. author .eeee...............................................................................................eeeeee.hhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhh.......eeeee.......................eeee.....................eeeee............hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh.............hhhhh..............................eeeee..........eeeeeeeeeee..eeeeeeeeeee.......eeeeeeee....eeeeeeee......eeeeeeeee..........eeeeeeeeee....eeeee..........eeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------LIPASE_SER--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PLAT  PDB: B:338-449 UniProt: 355-465                                                                           PROSITE
           Transcript 1 (1) Exon 1.3  PDB: B:1-50 UniProt: 16-67 [INCOMPLETE]  Exon 1.4  PDB: B:51-91 UniProt: 68-108   Exon 1.5a  PDB: B:92-136 UniProt: 109-153    Exon 1.6  PDB: B:137-174              ---------------------------------------Exon 1.8  PDB: B:214-254 UniProt: 231-271---------------------------------------Exon 1.10  PDB: B:294-337 UniProt: 311-354  -----------------------------------Exon 1.12  PDB: B:373-429 (gaps) UniProt: 390-445       -------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: B:174-214 UniProt: 191-231---------------------------------------Exon 1.9  PDB: B:254-293                -------------------------------------------Exon 1.11  PDB: B:337-373            ------------------------------------------------------Exon 1.13             Transcript 1 (2)
                 1lpa B   1 KEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC 449
                                    10        20        30|       39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399    || 410       420       430       440         
                                                        30A                                                                                                                                                                                                                                                                                                                                                                                   404|                                           
                                                                                                                                                                                                                                                                                                                                                                                                                                               406
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 4)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a/b) (23833)
(-)
Class: Small proteins (3458)

(-) CATH Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (4, 4)

Asymmetric/Biological Unit
(-)
Clan: AB_hydrolase (347)
(-)
Clan: PLAT (25)
(-)
Clan: no clan defined [family: Colipase] (5)
(-)
Clan: no clan defined [family: Colipase_C] (5)

(-) Gene Ontology  (15, 18)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (COL_PIG | P02703)
molecular function
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
biological process
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0016042    lipid catabolic process    The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B   (LIPP_HUMAN | P16233)
molecular function
    GO:0052689    carboxylic ester hydrolase activity    Catalysis of the hydrolysis of a carboxylic ester bond.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004806    triglyceride lipase activity    Catalysis of the reaction: triacylglycerol + H2O = diacylglycerol + a carboxylate.
biological process
    GO:0030299    intestinal cholesterol absorption    Uptake of cholesterol into the blood by absorption from the small intestine.
    GO:0016042    lipid catabolic process    The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0044241    lipid digestion    The whole of the physical, chemical, and biochemical processes carried out by living organisms to break down ingested lipids into components that may be easily absorbed and directed into metabolism.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0061365    positive regulation of triglyceride lipase activity    Any process that increases the activity of triglyceride lipase.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BNG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    CAT  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe B:297 - Pro B:298   [ RasMol ]  
    Ser B:15 - Pro B:16   [ RasMol ]  
    Val B:210 - Pro B:211   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1lpa
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COL_PIG | P02703
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  LIPP_HUMAN | P16233
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.1.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COL_PIG | P02703
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LIPP_HUMAN | P16233
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COL_PIG | P02703: 1eth 1lpb 1n8s 1pcn 1pco
        LIPP_HUMAN | P16233: 1gpl 1lpb 1n8s

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1LPA)