Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE PANCREATIC LIPASE-COLIPASE COMPLEX
 
Authors :  H. Van Tilbeurgh, L. Sarda, R. Verger, C. Cambillau
Date :  21 Nov 02  (Deposition) - 18 Dec 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.04
Chains :  Asym./Biol. Unit :  A,C
Keywords :  Hydrolase, Pancreas, Signal (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Van Tilbeurgh, L. Sarda, R. Verger, C. Cambillau
Structure Of The Pancreatic Lipase-Procolipase Complex
Nature V. 359 159 1992
PubMed-ID: 1522902  |  Reference-DOI: 10.1038/359159A0
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRIACYLGLYCEROL LIPASE, PANCREATIC
    ChainsA
    EC Number3.1.1.3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsPANCREATIC JUICE
    SynonymPANCREATIC LIPASE, PL
 
Molecule 2 - COLIPASE II
    ChainsC
    Organism CommonPIG
    Organism ScientificSUS SCROFA
    Organism Taxid9823
    Other DetailsEXTRACTED FROM PANCREAS

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1N8S)

(-) Sites  (0, 0)

(no "Site" information available for 1N8S)

(-) SS Bonds  (11, 11)

Asymmetric/Biological Unit
No.Residues
1A:4 -A:10
2A:90 -A:101
3A:237 -A:261
4A:285 -A:296
5A:299 -A:304
6A:433 -A:449
7C:517 -C:528
8C:523 -C:539
9C:527 -C:561
10C:549 -C:569
11C:563 -C:587

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Ser A:15 -Pro A:16
2Val A:210 -Pro A:211
3Phe A:297 -Pro A:298

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1N8S)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1COLIPASE_2PS51342 Colipase family profile.COL_PIG23-107  1C:506-590
2COLIPASE_1PS00121 Colipase signature.COL_PIG72-80  1C:555-563
3LIPASE_SERPS00120 Lipases, serine active site.LIPP_HUMAN163-172  1A:146-155
4PLATPS50095 PLAT domain profile.LIPP_HUMAN355-465  1A:338-449

(-) Exons   (11, 11)

Asymmetric/Biological Unit (11, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003692211ENSE00001449232chr10:118305443-11830547028LIPP_HUMAN-00--
1.2ENST000003692212ENSE00002173518chr10:118305605-11830565046LIPP_HUMAN1-16160--
1.3ENST000003692213ENSE00001193593chr10:118306806-118306960155LIPP_HUMAN16-67521A:1-5051
1.4ENST000003692214ENSE00000986714chr10:118307872-118307994123LIPP_HUMAN68-108411A:51-9141
1.5aENST000003692215aENSE00001097273chr10:118310610-118310744135LIPP_HUMAN109-153451A:92-13645
1.6ENST000003692216ENSE00001148734chr10:118313239-118313350112LIPP_HUMAN154-191381A:137-17438
1.7ENST000003692217ENSE00001097277chr10:118314690-118314809120LIPP_HUMAN191-231411A:174-21441
1.8ENST000003692218ENSE00001097284chr10:118314900-118315019120LIPP_HUMAN231-271411A:214-25441
1.9ENST000003692219ENSE00001097280chr10:118315512-118315630119LIPP_HUMAN271-310401A:254-29340
1.10ENST0000036922110ENSE00001097279chr10:118318666-118318795130LIPP_HUMAN311-354441A:294-33744
1.11ENST0000036922111ENSE00001097275chr10:118319928-118320036109LIPP_HUMAN354-390371A:337-37337
1.12ENST0000036922112ENSE00001097286chr10:118320984-118321148165LIPP_HUMAN390-445561A:373-429 (gaps)57
1.13ENST0000036922113ENSE00001097276chr10:118327247-118327367121LIPP_HUMAN445-465211A:429-44921

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:449
 aligned with LIPP_HUMAN | P16233 from UniProtKB/Swiss-Prot  Length:465

    Alignment length:449
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456         
           LIPP_HUMAN    17 KEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC 465
               SCOP domains d1n8sa2 A:1-336 Pancreatic lipase, N-terminal domain                                                                                                                                                                                                                                                                                             d1n8sa1 A:337-449 Pancreatic lipase, C-terminal domain                                                           SCOP domains
               CATH domains 1n8sA01 A:1-337  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                                                                                             1n8sA02 A:338-448 Lipoxygenase-1                                                                              - CATH domains
               Pfam domains Lipase-1n8sA01 A:1-335                                                                                                                                                                                                                                                                                                                          ----PLAT-1n8sA02 A:340-446                                                                                    --- Pfam domains
         Sec.struct. author ...ee...ee....................hhhhhh.eeeeee..eeeeeeee..hhhhhh........eeeeee......hhhhhhhhhhhhhhhhh.eeeeeeehhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeehhhhhhhhhhhhhh.....eeeee................hhhhh.eeeee.....................eeeee..................hhhhhhh......hhhhhhhhhhhhhhhh...........hhhhhhh................hhhhh........eeeee..........eeeeeeeeeee..eeeeeeeeeee..ee...eeeeeeee....eeeeeeee......eeeeeeeee.........eeeeeeeeee.....eeeee....ee....eeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------LIPASE_SER--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PLAT  PDB: A:338-449 UniProt: 355-465                                                                           PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-50 UniProt: 16-67 [INCOMPLETE]  Exon 1.4  PDB: A:51-91 UniProt: 68-108   Exon 1.5a  PDB: A:92-136 UniProt: 109-153    Exon 1.6  PDB: A:137-174              ---------------------------------------Exon 1.8  PDB: A:214-254 UniProt: 231-271---------------------------------------Exon 1.10  PDB: A:294-337 UniProt: 311-354  -----------------------------------Exon 1.12  PDB: A:373-429 (gaps) UniProt: 390-445       -------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:174-214 UniProt: 191-231---------------------------------------Exon 1.9  PDB: A:254-293                -------------------------------------------Exon 1.11  PDB: A:337-373            ------------------------------------------------------Exon 1.13             Transcript 1 (2)
                 1n8s A   1 KEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC 449
                                    10        20        30|       39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399    || 410       420       430       440         
                                                        30B                                                                                                                                                                                                                                                                                                                                                                                   404|                                           
                                                                                                                                                                                                                                                                                                                                                                                                                                               406                                           

Chain C from PDB  Type:PROTEIN  Length:85
 aligned with COL_PIG | P02703 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:85
                                    32        42        52        62        72        82        92       102     
              COL_PIG    23 GIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDV 107
               SCOP domains d1n8sc1 C:506-544 (Pro)colipase        d1n8sc2 C:545-590 (Pro)colipase                SCOP domains
               CATH domains 1n8sC00 C:506-590 Lipase, subunit A                                                   CATH domains
               Pfam domains Colipase-1n8sC01 C:506-543            -Colipase_C-1n8sC02 C:545-589                 - Pfam domains
         Sec.struct. author .............hhhhh....ee........ee........eee................eeeee............eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) COLIPASE_2  PDB: C:506-590 UniProt: 23-107                                            PROSITE (1)
                PROSITE (2) -------------------------------------------------COLIPASE_--------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 1n8s C 506 GIIINLDEGELCLNSAQCKSNCCQHDTILSLLRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHNV 590
                                   515       525       535       545       555       565       575       585     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (4, 4)

Asymmetric/Biological Unit
(-)
Clan: PLAT (25)

(-) Gene Ontology  (15, 18)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (LIPP_HUMAN | P16233)
molecular function
    GO:0052689    carboxylic ester hydrolase activity    Catalysis of the hydrolysis of a carboxylic ester bond.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004806    triglyceride lipase activity    Catalysis of the reaction: triacylglycerol + H2O = diacylglycerol + a carboxylate.
biological process
    GO:0030299    intestinal cholesterol absorption    Uptake of cholesterol into the blood by absorption from the small intestine.
    GO:0016042    lipid catabolic process    The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0044241    lipid digestion    The whole of the physical, chemical, and biochemical processes carried out by living organisms to break down ingested lipids into components that may be easily absorbed and directed into metabolism.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0061365    positive regulation of triglyceride lipase activity    Any process that increases the activity of triglyceride lipase.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain C   (COL_PIG | P02703)
molecular function
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
biological process
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0016042    lipid catabolic process    The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1n8s)
 
  Sites
(no "Sites" information available for 1n8s)
 
  Cis Peptide Bonds
    Phe A:297 - Pro A:298   [ RasMol ]  
    Ser A:15 - Pro A:16   [ RasMol ]  
    Val A:210 - Pro A:211   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1n8s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COL_PIG | P02703
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  LIPP_HUMAN | P16233
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  COL_PIG | P02703
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LIPP_HUMAN | P16233
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COL_PIG | P027031eth 1lpa 1lpb 1pcn 1pco
        LIPP_HUMAN | P162331gpl 1lpa 1lpb

(-) Related Entries Specified in the PDB File

1lpa 1lpb