|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1LFE) |
Sites (0, 0)| (no "Site" information available for 1LFE) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1LFE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1LFE) |
SAPs(SNPs)/Variants (5, 5)
Theoretical Model (5, 5)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 4)
Theoretical Model (1, 4)
|
||||||||||||||||||||||||
Exons (3, 3)
Theoretical Model (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Theoretical ModelChain A from PDB Type:PROTEIN Length:173 aligned with CRGC_HUMAN | P07315 from UniProtKB/Swiss-Prot Length:174 Alignment length:173 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 CRGC_HUMAN 2 GKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY 174 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---PL-----------------------------------------H--------------------------------------------------------------------------------C--------------------------------------W------ SAPs(SNPs) PROSITE CRYSTALLIN_BETA_GAMMA PDB: A:1-39 CRYSTALLIN_BETA_GAMMA PDB: A:40-82 ----CRYSTALLIN_BETA_GAMMA PDB: A:87-127 CRYSTALLIN_BETA_GAMMA PDB: A:128-170 --- PROSITE Transcript 1 1.Exon 1.2 PDB: A:3-83 UniProt: 4-84 Exon 1.3 PDB: A:84-173 UniProt: 85-174 Transcript 1 1lfe A 1 GKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHYLEGCWVLYELPNYRGRGYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY 173 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1LFE) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1LFE) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1LFE) |
Gene Ontology (5, 5)|
Theoretical Model(hide GO term definitions) Chain A (CRGC_HUMAN | P07315)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|