Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  ELUCIDATION OF THE PRIMARY AND THREE-DIMENSIONAL STRUCTURE OF THE UTEROTONIC POLYPEPTIDE KALATA B1
 
Authors :  D. J. Craik, D. G. Norman
Date :  13 Jan 95  (Deposition) - 31 Mar 95  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  O. Saether, D. J. Craik, I. D. Campbell, K. Sletten, J. Juul, D. G. Norman
Elucidation Of The Primary And Three-Dimensional Structure Of The Uterotonic Polypeptide Kalata B1.
Biochemistry V. 34 4147 1995
PubMed-ID: 7703226  |  Reference-DOI: 10.1021/BI00013A002
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KALATA B1
    ChainsA
    EngineeredYES
    Organism ScientificOLDENLANDIA AFFINIS
    Organism Taxid60225

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KAL)

(-) Sites  (0, 0)

(no "Site" information available for 1KAL)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:5 -A:22
2A:13 -A:27
3A:17 -A:29

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KAL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KAL)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYCLOTIDEPS51052 Cyclotides profile.KAB1_OLDAF89-117  1A:9-29
2CYCLOTIDE_MOEBIUSPS60009 Cyclotides Moebius subfamily signature.KAB1_OLDAF93-102  1A:13-22

(-) Exons   (0, 0)

(no "Exon" information available for 1KAL)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:29
 aligned with KAB1_OLDAF | P56254 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:107
                                    12        22        32        42        52        62        72        82        92       102       
           KAB1_OLDAF     3 KFTVCLLLCLLLAAFVGAFGSELSDSHKTTLVNEIAEKMLQRKILDGVEATLVTDVAEKMFLRKMKAEAKTSETADQVFLKQLQLKGLPVCGETCVGGTCNTPGCTC 109
               SCOP domains d1kal                                   a_                                            A: Kalata B1          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------Cyclotide-1kalA01     Pfam domains
         Sec.struct. author .....-----------------------------------ee-------------------------------------------..ee.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------------------CYCLOTIDE  PDB: A:9-2 PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------CYCLOTIDE_------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 1kal A   1 SWPVC-----------------------------------TR-------------------------------------------NGLPVCGETCVGGTCNTPGCTC  29
                                |    -         -         -         -||       -         -         -         -     |  12        22       
                                5                                   6|                                           8                     
                                                                     7                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1KAL)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (KAB1_OLDAF | P56254)
biological process
    GO:0019835    cytolysis    The rupture of cell membranes and the loss of cytoplasm.
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0044179    hemolysis in other organism    The cytolytic destruction of red blood cells, with the release of intracellular hemoglobin, in one organism by another.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kal)
 
  Sites
(no "Sites" information available for 1kal)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kal)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kal
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAB1_OLDAF | P56254
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAB1_OLDAF | P56254
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAB1_OLDAF | P562541jjz 1k48 1n1u 1nb1 1orx 1znu 2f2i 2f2j 2jue 2khb 2mh1 2mn1 4ttm 4ttn 4tto

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KAL)