1K62 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HUMAN ARGININOSUCCINATE LYASE Q286R MUTANT

Authors :   L. M. Sampaleanu, F. Vallee, G. D. Thompson, P. L. Howell

Date :   14 Oct 01 (Deposition) - 01 Feb 02 (Release) - 13 May 08 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.65

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Intragenic Complementation, Arginiosuccinate Lyase, Delta Crystallin, Enzyme Mechanism (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. M. Sampaleanu, F. Vallee, G. D. Thompson, P. L. Howell
Three-Dimensional Structure Of The Argininosuccinate Lyase Frequently Complementing Allele Q286R.
Biochemistry V. 40 15570 2001
PubMed-ID: 11747432 | Reference-DOI: 10.1021/BI011525M
(for further references see the PDB file header)

Molecule 1 - ARGININOSUCCINATE LYASE
	Chains	:	A, B
	EC Number	:	4.3.2.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PET3C
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ARGINOSUCCINASE; ASAL

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1K62)

(no "Site" information available for 1K62)

(no "SS Bond" information available for 1K62)

Asymmetric Unit

No.	Residues
1	Ser A:319	-	Thr A:320
2	Ser B:319	-	Thr B:320

Asymmetric Unit (61, 122)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_043106	D	31	N	ARLY_HUMAN	Disease (ARGINSA)	754995756	A/B	D	31	N
02	UniProt	VAR_072186	V	70	A	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	V	70	A
03	UniProt	VAR_075551	E	73	K	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	E	73	K
04	UniProt	VAR_072187	R	94	C	ARLY_HUMAN	Disease (ARGINSA)	374304304	A/B	R	94	C
05	UniProt	VAR_072188	R	94	H	ARLY_HUMAN	Disease (ARGINSA)	777437569	A/B	R	94	H
06	UniProt	VAR_000676	R	95	C	ARLY_HUMAN	Disease (ARGINSA)	28940585	A/B	R	95	C
07	UniProt	VAR_072189	R	95	H	ARLY_HUMAN	Disease (ARGINSA)	150244667	A/B	R	95	H
08	UniProt	VAR_072190	A	104	V	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	A	104	V
09	UniProt	VAR_000677	R	111	W	ARLY_HUMAN	Disease (ARGINSA)	138310841	A/B	R	111	W
10	UniProt	VAR_043107	R	113	Q	ARLY_HUMAN	Disease (ARGINSA)	752783461	A/B	R	113	Q
11	UniProt	VAR_072191	D	120	E	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	D	120	E
12	UniProt	VAR_072192	L	121	H	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	121	H
13	UniProt	VAR_072193	R	126	W	ARLY_HUMAN	Disease (ARGINSA)	201962738	A/B	R	126	W
14	UniProt	VAR_072194	R	146	W	ARLY_HUMAN	Disease (ARGINSA)	199938613	A/B	R	146	W
15	UniProt	VAR_072195	P	156	R	ARLY_HUMAN	Disease (ARGINSA)	769017508	A/B	P	156	R
16	UniProt	VAR_072196	H	160	N	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	H	160	N
17	UniProt	VAR_072197	P	166	H	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	P	166	H
18	UniProt	VAR_072198	R	168	H	ARLY_HUMAN	Disease (ARGINSA)	727503811	A/B	R	168	H
19	UniProt	VAR_072199	S	170	N	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	S	170	N
20	UniProt	VAR_017572	V	178	M	ARLY_HUMAN	Disease (ARGINSA)	28941473	A/B	V	178	M
21	UniProt	VAR_072200	L	180	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	180	R
22	UniProt	VAR_036281	T	181	S	ARLY_HUMAN	Unclassified	---	A/B	T	181	S
23	UniProt	VAR_072201	R	182	Q	ARLY_HUMAN	Disease (ARGINSA)	751590073	A/B	R	182	Q
24	UniProt	VAR_043108	R	186	Q	ARLY_HUMAN	Disease (ARGINSA)	752397242	A/B	R	186	Q
25	UniProt	VAR_072202	R	191	W	ARLY_HUMAN	Disease (ARGINSA)	143508372	A/B	R	191	W
26	UniProt	VAR_000678	R	193	Q	ARLY_HUMAN	Disease (ARGINSA)	373697663	A/B	R	193	Q
27	UniProt	VAR_072203	R	193	W	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	R	193	W
28	UniProt	VAR_036282	G	200	V	ARLY_HUMAN	Unclassified	---	A/B	G	200	V
29	UniProt	VAR_072204	A	205	V	ARLY_HUMAN	Disease (ARGINSA)	796051925	A/B	A	205	V
30	UniProt	VAR_072205	R	213	Q	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	R	213	Q
31	UniProt	VAR_072206	L	227	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	227	P
32	UniProt	VAR_072207	S	229	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	S	229	R
33	UniProt	VAR_072208	S	229	T	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	S	229	T
34	UniProt	VAR_072209	D	231	E	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	D	231	E
35	UniProt	VAR_043109	R	236	W	ARLY_HUMAN	Disease (ARGINSA)	761268464	A/B	R	236	W
36	UniProt	VAR_072210	D	237	N	ARLY_HUMAN	Disease (ARGINSA)	552951774	A/B	D	237	N
37	UniProt	VAR_072211	M	256	T	ARLY_HUMAN	Disease (ARGINSA)	149057077	A/B	M	256	T
38	UniProt	VAR_072212	L	262	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	262	P
39	UniProt	VAR_000679	Q	286	R	ARLY_HUMAN	Disease (ARGINSA)	28941472	A/B	R	286	R
40	UniProt	VAR_072213	L	295	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	295	P
41	UniProt	VAR_075552	R	297	Q	ARLY_HUMAN	Disease (ARGINSA)	750431938	A/B	R	297	Q
42	UniProt	VAR_072214	G	301	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	G	301	R
43	UniProt	VAR_072215	R	306	W	ARLY_HUMAN	Disease (ARGINSA)	868834862	A/B	R	306	W
44	UniProt	VAR_072216	D	324	A	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	D	324	A
45	UniProt	VAR_072217	Q	326	L	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	Q	326	L
46	UniProt	VAR_043110	V	335	L	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	V	335	L
47	UniProt	VAR_072218	L	343	F	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	343	F
48	UniProt	VAR_072219	L	343	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	343	P
49	UniProt	VAR_072220	M	368	V	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	M	368	V
50	UniProt	VAR_017573	R	379	C	ARLY_HUMAN	Disease (ARGINSA)	28940287	A/B	R	379	C
51	UniProt	VAR_072221	K	380	E	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	K	380	E
52	UniProt	VAR_043111	M	382	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	M	382	R
53	UniProt	VAR_017574	R	385	C	ARLY_HUMAN	Disease (ARGINSA)	28940286	A/B	R	385	C
54	UniProt	VAR_072222	R	385	H	ARLY_HUMAN	Disease (ARGINSA)	746120802	A/B	R	385	H
55	UniProt	VAR_072223	R	385	L	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	R	385	L
56	UniProt	VAR_072224	H	388	Q	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	H	388	Q
57	UniProt	VAR_072225	S	433	R	ARLY_HUMAN	Disease (ARGINSA)	796051928	A/B	S	433	R
58	UniProt	VAR_072226	V	434	L	ARLY_HUMAN	Disease (ARGINSA)	773071023	A/B	V	434	L
59	UniProt	VAR_072227	S	447	N	ARLY_HUMAN	Disease (ARGINSA)	373519615	A/B	S	447	N
60	UniProt	VAR_072228	R	456	Q	ARLY_HUMAN	Disease (ARGINSA)	767271619	A/B	R	456	Q
61	UniProt	VAR_043112	R	456	W	ARLY_HUMAN	Disease (ARGINSA)	759396688	A/B	R	456	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (61, 244)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_043106	D	31	N	ARLY_HUMAN	Disease (ARGINSA)	754995756	A/B	D	31	N
02	UniProt	VAR_072186	V	70	A	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	V	70	A
03	UniProt	VAR_075551	E	73	K	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	E	73	K
04	UniProt	VAR_072187	R	94	C	ARLY_HUMAN	Disease (ARGINSA)	374304304	A/B	R	94	C
05	UniProt	VAR_072188	R	94	H	ARLY_HUMAN	Disease (ARGINSA)	777437569	A/B	R	94	H
06	UniProt	VAR_000676	R	95	C	ARLY_HUMAN	Disease (ARGINSA)	28940585	A/B	R	95	C
07	UniProt	VAR_072189	R	95	H	ARLY_HUMAN	Disease (ARGINSA)	150244667	A/B	R	95	H
08	UniProt	VAR_072190	A	104	V	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	A	104	V
09	UniProt	VAR_000677	R	111	W	ARLY_HUMAN	Disease (ARGINSA)	138310841	A/B	R	111	W
10	UniProt	VAR_043107	R	113	Q	ARLY_HUMAN	Disease (ARGINSA)	752783461	A/B	R	113	Q
11	UniProt	VAR_072191	D	120	E	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	D	120	E
12	UniProt	VAR_072192	L	121	H	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	121	H
13	UniProt	VAR_072193	R	126	W	ARLY_HUMAN	Disease (ARGINSA)	201962738	A/B	R	126	W
14	UniProt	VAR_072194	R	146	W	ARLY_HUMAN	Disease (ARGINSA)	199938613	A/B	R	146	W
15	UniProt	VAR_072195	P	156	R	ARLY_HUMAN	Disease (ARGINSA)	769017508	A/B	P	156	R
16	UniProt	VAR_072196	H	160	N	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	H	160	N
17	UniProt	VAR_072197	P	166	H	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	P	166	H
18	UniProt	VAR_072198	R	168	H	ARLY_HUMAN	Disease (ARGINSA)	727503811	A/B	R	168	H
19	UniProt	VAR_072199	S	170	N	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	S	170	N
20	UniProt	VAR_017572	V	178	M	ARLY_HUMAN	Disease (ARGINSA)	28941473	A/B	V	178	M
21	UniProt	VAR_072200	L	180	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	180	R
22	UniProt	VAR_036281	T	181	S	ARLY_HUMAN	Unclassified	---	A/B	T	181	S
23	UniProt	VAR_072201	R	182	Q	ARLY_HUMAN	Disease (ARGINSA)	751590073	A/B	R	182	Q
24	UniProt	VAR_043108	R	186	Q	ARLY_HUMAN	Disease (ARGINSA)	752397242	A/B	R	186	Q
25	UniProt	VAR_072202	R	191	W	ARLY_HUMAN	Disease (ARGINSA)	143508372	A/B	R	191	W
26	UniProt	VAR_000678	R	193	Q	ARLY_HUMAN	Disease (ARGINSA)	373697663	A/B	R	193	Q
27	UniProt	VAR_072203	R	193	W	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	R	193	W
28	UniProt	VAR_036282	G	200	V	ARLY_HUMAN	Unclassified	---	A/B	G	200	V
29	UniProt	VAR_072204	A	205	V	ARLY_HUMAN	Disease (ARGINSA)	796051925	A/B	A	205	V
30	UniProt	VAR_072205	R	213	Q	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	R	213	Q
31	UniProt	VAR_072206	L	227	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	227	P
32	UniProt	VAR_072207	S	229	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	S	229	R
33	UniProt	VAR_072208	S	229	T	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	S	229	T
34	UniProt	VAR_072209	D	231	E	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	D	231	E
35	UniProt	VAR_043109	R	236	W	ARLY_HUMAN	Disease (ARGINSA)	761268464	A/B	R	236	W
36	UniProt	VAR_072210	D	237	N	ARLY_HUMAN	Disease (ARGINSA)	552951774	A/B	D	237	N
37	UniProt	VAR_072211	M	256	T	ARLY_HUMAN	Disease (ARGINSA)	149057077	A/B	M	256	T
38	UniProt	VAR_072212	L	262	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	262	P
39	UniProt	VAR_000679	Q	286	R	ARLY_HUMAN	Disease (ARGINSA)	28941472	A/B	R	286	R
40	UniProt	VAR_072213	L	295	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	295	P
41	UniProt	VAR_075552	R	297	Q	ARLY_HUMAN	Disease (ARGINSA)	750431938	A/B	R	297	Q
42	UniProt	VAR_072214	G	301	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	G	301	R
43	UniProt	VAR_072215	R	306	W	ARLY_HUMAN	Disease (ARGINSA)	868834862	A/B	R	306	W
44	UniProt	VAR_072216	D	324	A	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	D	324	A
45	UniProt	VAR_072217	Q	326	L	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	Q	326	L
46	UniProt	VAR_043110	V	335	L	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	V	335	L
47	UniProt	VAR_072218	L	343	F	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	343	F
48	UniProt	VAR_072219	L	343	P	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	L	343	P
49	UniProt	VAR_072220	M	368	V	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	M	368	V
50	UniProt	VAR_017573	R	379	C	ARLY_HUMAN	Disease (ARGINSA)	28940287	A/B	R	379	C
51	UniProt	VAR_072221	K	380	E	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	K	380	E
52	UniProt	VAR_043111	M	382	R	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	M	382	R
53	UniProt	VAR_017574	R	385	C	ARLY_HUMAN	Disease (ARGINSA)	28940286	A/B	R	385	C
54	UniProt	VAR_072222	R	385	H	ARLY_HUMAN	Disease (ARGINSA)	746120802	A/B	R	385	H
55	UniProt	VAR_072223	R	385	L	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	R	385	L
56	UniProt	VAR_072224	H	388	Q	ARLY_HUMAN	Disease (ARGINSA)	---	A/B	H	388	Q
57	UniProt	VAR_072225	S	433	R	ARLY_HUMAN	Disease (ARGINSA)	796051928	A/B	S	433	R
58	UniProt	VAR_072226	V	434	L	ARLY_HUMAN	Disease (ARGINSA)	773071023	A/B	V	434	L
59	UniProt	VAR_072227	S	447	N	ARLY_HUMAN	Disease (ARGINSA)	373519615	A/B	S	447	N
60	UniProt	VAR_072228	R	456	Q	ARLY_HUMAN	Disease (ARGINSA)	767271619	A/B	R	456	Q
61	UniProt	VAR_043112	R	456	W	ARLY_HUMAN	Disease (ARGINSA)	759396688	A/B	R	456	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FUMARATE_LYASES	PS00163	Fumarate lyases signature.	ARLY_HUMAN	280-289	2	A:280-289 B:280-289

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FUMARATE_LYASES	PS00163	Fumarate lyases signature.	ARLY_HUMAN	280-289	4	A:280-289 B:280-289

Asymmetric Unit (15, 30)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1e	ENST00000395332	1e	ENSE00001892728	chr7:65540861-65541080	220	ARLY_HUMAN	1-4	4	0	-	-
1.2	ENST00000395332	2	ENSE00001131469	chr7:65546790-65546984	195	ARLY_HUMAN	5-69	65	2	A:15-69 B:6-69	55 64
1.3b	ENST00000395332	3b	ENSE00001802017	chr7:65547355-65547438	84	ARLY_HUMAN	70-97	28	2	A:70-97 B:70-97	28 28
1.4a	ENST00000395332	4a	ENSE00001167573	chr7:65547867-65547923	57	ARLY_HUMAN	98-116	19	2	A:98-116 B:98-116	19 19
1.4c	ENST00000395332	4c	ENSE00001167566	chr7:65548064-65548161	98	ARLY_HUMAN	117-149	33	2	A:117-149 B:117-149	33 33
1.5	ENST00000395332	5	ENSE00001167562	chr7:65551572-65551649	78	ARLY_HUMAN	149-175	27	2	A:149-175 B:149-175	27 27
1.6a	ENST00000395332	6a	ENSE00001167557	chr7:65551731-65551808	78	ARLY_HUMAN	175-201	27	2	A:175-201 B:175-201	27 27
1.7	ENST00000395332	7	ENSE00001167550	chr7:65552321-65552373	53	ARLY_HUMAN	201-219	19	2	A:201-219 B:201-219	19 19
1.8b	ENST00000395332	8b	ENSE00001167543	chr7:65552716-65552778	63	ARLY_HUMAN	219-240	22	2	A:219-240 B:219-240	22 22
1.9	ENST00000395332	9	ENSE00002193541	chr7:65553794-65553908	115	ARLY_HUMAN	240-278	39	2	A:240-278 B:240-278	39 39
1.10b	ENST00000395332	10b	ENSE00002174283	chr7:65554078-65554162	85	ARLY_HUMAN	278-306	29	2	A:278-306 B:278-306	29 29
1.10f	ENST00000395332	10f	ENSE00002192919	chr7:65554263-65554322	60	ARLY_HUMAN	307-326	20	2	A:307-326 B:307-326	20 20
1.11	ENST00000395332	11	ENSE00002182971	chr7:65554599-65554682	84	ARLY_HUMAN	327-354	28	2	A:327-354 B:327-354	28 28
1.13	ENST00000395332	13	ENSE00002163544	chr7:65556993-65557073	81	ARLY_HUMAN	355-381	27	2	A:355-381 B:355-381	27 27
1.14	ENST00000395332	14	ENSE00002167364	chr7:65557544-65557650	107	ARLY_HUMAN	382-417	36	2	A:382-417 B:382-417	36 36
1.15c	ENST00000395332	15c	ENSE00001821476	chr7:65557755-65557918	164	ARLY_HUMAN	417-464	48	2	A:417-464 B:417-464	48 48

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:450
 aligned with ARLY_HUMAN | P04424 from UniProtKB/Swiss-Prot  Length:464

    Alignment length:450
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464
           ARLY_HUMAN    15 GAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA 464
               SCOP domains d1k62a_ A: Argininosuccinate lyase/delta-crystallin                                                                                                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains ------------1k62A01 A:27-123,A:195-234 Fumarase/aspartase (N-terminal domain)                                1k62A02 A:124-194,A:235-364,A:437-463                                  1k62A01 A:27-123,A:195-234              1k62A02 A:124-194,A:235-364,A:437-463 Fumarase/aspartase (Central domain)                                                         1k62A03 A:365-436 Fumarase/aspartase (C-terminal domain)                1k62A02                    - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhee..............hhhhhhhhh...ee..hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee.................hhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheehhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh......hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ----------------N--------------------------------------A--K--------------------CC--------V------W-Q------EH----W-------------------W---------R---N-----H-H-N-------M-RSQ---Q----W-Q------V----V-------Q-------------P-R-E----WN------------------T-----P-----------------------R--------P-Q---R----W-----------------A-L--------L-------F------------------------V----------CE-R--C--Q--------------------------------------------RL------------N--------Q-------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------HH-------------------------------------------------------------------------------------------------W-----------------------------------T-----------------------------------------------------------------------------------------------------------------P-----------------------------------------H----------------------------------------------------------------------W-------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FUMARATE_L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:15-69 UniProt: 5-69 [INCOMPLETE]      Exon 1.3b  PDB: A:70-97     Exon 1.4a          Exon 1.4c  PDB: A:117-149        -------------------------Exon 1.6a  PDB: A:175-201  -----------------Exon 1.8b             -------------------------------------Exon 1.10b  PDB: A:278-306   Exon 1.10f          Exon 1.11  PDB: A:327-354   Exon 1.13  PDB: A:355-381  Exon 1.14  PDB: A:382-417           ----------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: A:149-175   -------------------------Exon 1.7           --------------------Exon 1.9  PDB: A:240-278               ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.15c  PDB: A:417-464 UniProt: 417-464      Transcript 1 (2)
                 1k62 A  15 GAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA 464
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464

Chain B from PDB  Type:PROTEIN  Length:459
 aligned with ARLY_HUMAN | P04424 from UniProtKB/Swiss-Prot  Length:464

    Alignment length:459
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455         
           ARLY_HUMAN     6 GKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA 464
               SCOP domains d1k62b_ B: Argininosuccinate lyase/delta-crystallin                                                                                                                                                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains ---------------------1k62B01 B:27-123,B:195-234 Fumarase/aspartase (N-terminal domain)                                1k62B02 B:124-194,B:235-364,B:437-463                                  1k62B01 B:27-123,B:195-234              1k62B02 B:124-194,B:235-364,B:437-463 Fumarase/aspartase (Central domain)                                                         1k62B03 B:365-436 Fumarase/aspartase (C-terminal domain)                1k62B02                    - CATH domains
           Pfam domains (1) -----Lyase_1-1k62B01 B:11-305                                                                                                                                                                                                                                                                               --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----Lyase_1-1k62B02 B:11-305                                                                                                                                                                                                                                                                               --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ............hhhhhhh..hhhhhh.hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhh..hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......ee.hhhhhee.......eehhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheehhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhhh.hhhhhhh........hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------------------N--------------------------------------A--K--------------------CC--------V------W-Q------EH----W-------------------W---------R---N-----H-H-N-------M-RSQ---Q----W-Q------V----V-------Q-------------P-R-E----WN------------------T-----P-----------------------R--------P-Q---R----W-----------------A-L--------L-------F------------------------V----------CE-R--C--Q--------------------------------------------RL------------N--------Q-------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------HH-------------------------------------------------------------------------------------------------W-----------------------------------T-----------------------------------------------------------------------------------------------------------------P-----------------------------------------H----------------------------------------------------------------------W-------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FUMARATE_L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:6-69 UniProt: 5-69 [INCOMPLETE]                Exon 1.3b  PDB: B:70-97     Exon 1.4a          Exon 1.4c  PDB: B:117-149        -------------------------Exon 1.6a  PDB: B:175-201  -----------------Exon 1.8b             -------------------------------------Exon 1.10b  PDB: B:278-306   Exon 1.10f          Exon 1.11  PDB: B:327-354   Exon 1.13  PDB: B:355-381  Exon 1.14  PDB: B:382-417           ----------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: B:149-175   -------------------------Exon 1.7           --------------------Exon 1.9  PDB: B:240-278               ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.15c  PDB: B:417-464 UniProt: 417-464      Transcript 1 (2)
                 1k62 B   6 GKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA 464
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: L-aspartase-like (67)

Superfamily: L-aspartase-like (67)

Family: L-aspartase/fumarase (39)

Protein domain: Argininosuccinate lyase/delta-crystallin (14)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1k62a_	A:
1b	d1k62b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Fumarase C; Chain B, domain 1 (57)

Homologous Superfamily: Fumarase/aspartase (N-terminal domain) (57)

Human (Homo sapiens) (2)

1a	1k62A01	A:27-123,A:195-234
1b	1k62B01	B:27-123,B:195-234

Topology: Ribonucleotide Reductase Protein R1; domain 1 (62)

Homologous Superfamily: Fumarase/aspartase (C-terminal domain) (42)

Human (Homo sapiens) (2)

2a	1k62A03	A:365-436
2b	1k62B03	B:365-436

Architecture: Up-down Bundle (3216)

Topology: Fumarase C; Chain A, domain 2 (60)

Homologous Superfamily: Fumarase/aspartase (Central domain) (59)

Human (Homo sapiens) (2)

3a	1k62A02	A:124-194,A:235-364,A:437-463
3b	1k62B02	B:124-194,B:235-364,B:437-463

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Lyase_1] (27)

Family: Lyase_1 (27)

Homo sapiens (Human) (2)

1a	Lyase_1-1k62B01	B:11-305
1b	Lyase_1-1k62B02	B:11-305

Asymmetric Unit(hide GO term definitions)

Chain A,B (ARLY_HUMAN | P04424)

molecular function
	GO:0004056	argininosuccinate lyase activity	Catalysis of the reaction: N-(L-arginino)succinate = fumarate + L-arginine.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006526	arginine biosynthetic process	The chemical reactions and pathways resulting in the formation of arginine, 2-amino-5-(carbamimidamido)pentanoic acid.
	GO:0042450	arginine biosynthetic process via ornithine	The chemical reactions and pathways resulting in the formation of arginine (2-amino-5-guanidinopentanoic acid) via the intermediate compound ornithine.
	GO:0006527	arginine catabolic process	The chemical reactions and pathways resulting in the breakdown of arginine, 2-amino-5-(carbamimidamido)pentanoic acid.
	GO:0008652	cellular amino acid biosynthetic process	The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
	GO:0006475	internal protein amino acid acetylation	The addition of an acetyl group to a non-terminal amino acid in a protein.
	GO:0051262	protein tetramerization	The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
	GO:0000050	urea cycle	The sequence of reactions by which arginine is synthesized from ornithine, then cleaved to yield urea and regenerate ornithine. The overall reaction equation is NH3 + CO2 + aspartate + 3 ATP + 2 H2O = urea + fumarate + 2 ADP + 2 phosphate + AMP + diphosphate.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1k62)

	Sites
(no "Sites" information available for 1k62)

	Cis Peptide Bonds
		Ser A:319 - Thr A:320	[ RasMol ]
		Ser B:319 - Thr B:320	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1k62
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARLY_HUMAN \| P04424
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.3.2.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	207900
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARLY_HUMAN \| P04424
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ARLY_HUMAN \| P04424	:	1aos

1aos	ARGININOSUCCINATE LYASE (HUMAN)
1auw	DUCK DELTA 2 CRYSTALLIN H91N MUTANT
1dcn	DUCK DELTA 2 CRYSTALLIN H162N MUTANT
1hy0	WILD TYPE DUCK DELTA 1 CRYSTALLIN
1hy1	WILD TYPE DUCK DELTA 2 CRYSTALLIN
1i0a	WILD TYPE TURKEY DELTA 1 CRYSTALLIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (61, 122)

PROSITE Motifs (1, 2)

Exons (15, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (3, 6)

Pfam Domains (1, 2)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File