1J1L - JenaLib

Title :   CRYSTAL STRUCTURE OF HUMAN PIRIN: A BCL-3 AND NUCLEAR FACTOR I INTERACTING PROTEIN AND A CUPIN SUPERFAMILY MEMBER

Authors :   H. Pang, M. Bartlam, Q. Zeng, G. F. Gao, Z. Rao

Date :   10 Dec 02 (Deposition) - 16 Dec 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A

Keywords :   Beta Sandwich, Cupin, Iron, Metatl Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Pang, M. Bartlam, Q. Zeng, H. Miyatake, T. Hisano, K. Miki, L. L. Wong, G. F. Gao, Z. Rao
Crystal Structure Of Human Pirin: An Iron-Binding Nuclear Protein And Transcription Cofactor
J. Biol. Chem. V. 279 1491 2004
PubMed-ID: 14573596 | Reference-DOI: 10.1074/JBC.M310022200
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 7)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (9, 9)

Asymmetric/Biological Unit (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000380421	1a	ENSE00001919512	X:15511687-15511279	409	PIR_HUMAN	-	0	0	-	-
1.2a	ENST00000380421	2a	ENSE00002157436	X:15509432-15509285	148	PIR_HUMAN	1-32	32	1	A:3-32	30
1.3	ENST00000380421	3	ENSE00000385079	X:15497944-15497852	93	PIR_HUMAN	33-63	31	1	A:33-63	31
1.5	ENST00000380421	5	ENSE00000665884	X:15477863-15477780	84	PIR_HUMAN	64-91	28	1	A:64-91	28
1.6	ENST00000380421	6	ENSE00000665885	X:15474177-15473971	207	PIR_HUMAN	92-160	69	1	A:92-160	69
1.8	ENST00000380421	8	ENSE00001219767	X:15444113-15444029	85	PIR_HUMAN	161-189	29	1	A:161-189	29
1.9b	ENST00000380421	9b	ENSE00001206569	X:15425672-15425628	45	PIR_HUMAN	189-204	16	1	A:189-204	16
1.10	ENST00000380421	10	ENSE00001206562	X:15415653-15415571	83	PIR_HUMAN	204-231	28	1	A:204-231	28
1.11a	ENST00000380421	11a	ENSE00001091193	X:15408373-15408307	67	PIR_HUMAN	232-254	23	1	A:232-254	23
1.12	ENST00000380421	12	ENSE00001820668	X:15403238-15402921	318	PIR_HUMAN	254-290	37	1	A:254-290	37

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:288
 aligned with PIR_HUMAN | O00625 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:288
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
            PIR_HUMAN     3 SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN 290
               SCOP domains d1j1la_ A: Pirin                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1j1lA01    1j1lA02 A:14-139,A:247-283 Jelly Rolls                                                                                        1j1lA01 A:3-13,A:140-246 Jelly Rolls                                                                       1j1lA02 A:14-139,A:247-283           ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeee..eeee...eeeee............eeeeeeeee.....eeeeee..eeeeeee.....eeeee....eeee....eeeee....eeeeeee.....eeeeeeeee.hhhhh....eeeeehhhhh...ee..eeeeeee.ee..ee........eeeeeeee....eeeee.....eeeeeeee..eee......eee...eeeee....eeeee......eeeeeeee.......eee..eee.hhhhhhhhhhhhhh....hhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A-------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:3-32        Exon 1.3  PDB: A:33-63         Exon 1.5  PDB: A:64-91      Exon 1.6  PDB: A:92-160 UniProt: 92-160                              Exon 1.8  PDB: A:161-189     --------------Exon 1.10  PDB: A:204-231   Exon 1.11a             ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b       -------------------------------------------------Exon 1.12  PDB: A:254-290             Transcript 1 (2)
                 1j1l A   3 SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSmAHEDFCGHTGKmNPGDLQWmTAGRGILHAEmPCSEEPAHGLQLWVNLRSSEKmVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVmNTNEEISQAILDFRNAKNGFERAKTWKSKIGN 290
                                    12        22        32        42        52        62        72|       82  |     92|      102 |     112       122   |   132       142       152       162       172       182       192       202       212       222       232       242       252     | 262       272       282        
                                                                                                 73-MSE      85-MSE  93-MSE    104-MSE               126-MSE                                                                                                                             258-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PIR_HUMAN | O00625)

molecular function
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008127	quercetin 2,3-dioxygenase activity	Catalysis of the reaction: H(+) + O(2) + quercetin = 2-(3,4-dihydroxybenzoyloxy)-4,6-dihydroxybenzoate + CO.
	GO:0003712	transcription cofactor activity	Interacting selectively and non-covalently with a regulatory transcription factor and also with the basal transcription machinery in order to modulate transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between regulatory transcription factors and the basal transcription machinery.
biological process
	GO:0030224	monocyte differentiation	The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of a monocyte.
	GO:0030099	myeloid cell differentiation	The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FE2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:49 - Pro A:50	[ RasMol ]
		Asp A:37 - Pro A:38	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1j1l
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PIR_HUMAN \| O00625
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description