Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN PIRIN IN COMPLEX WITH A CHEMICAL PROBE PYRROLIDINE 24
 
Authors :  S. Ali, R. Van Montfort
Date :  15 Apr 16  (Deposition) - 11 Jan 17  (Release) - 25 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.73
Chains :  Asym./Biol. Unit :  A
Keywords :  Cupin, Beta-Barrel Fold, Inhibitor, Complex, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Cheeseman, N. E. Chessum, C. S. Rye, A. E. Pasqua, M. J. Tucker, B. Wilding, L. E. Evans, S. Lepri, M. Richards, S. Y. Sharp, S. Ali, M. Rowlands, L. O'Fee, A. Miah, A. Hayes, A. T. Henley, M. Powers, R. Te Poele, E. De Billy, L. Pellegrino, F. Raynaud, R. Burke, R. L. Van Montfort, S. A. Eccles, P. Workman, K. Jones
Discovery Of A Chemical Probe Bisamide (Cct251236): An Orally Bioavailable Efficacious Pirin Ligand From A Heat Shock Transcription Factor 1 (Hsf1) Phenotypic Screen.
J. Med. Chem. V. 60 180 2017
PubMed-ID: 28004573  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B01055

(-) Compounds

Molecule 1 - PIRIN
    Chains: A
    EC Number: 1.13.11.24
    Engineered: YES
    Expression System: ESCHERICHIA COLI K-12
    Expression System Plasmid: PET28A
    Expression System Taxid: 83333
    Gene: PIR
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PROBABLE QUERCETIN 2,3-DIOXYGENASE PIR,PROBABLE QUERCETINASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric/Biological Unit (4, 5)
No.NameCountTypeFull Name
16JQ1Ligand/IonN-{5-[(2,3-DIHYDRO-1,4-BENZODIOXINE-6-CARBONYL)AMINO]-2-METHYLPHENYL}-2-[3-(PYRROLIDIN-1-YL)PROPYL]QUINOLINE-6-CARBOXAMIDE
2DMS2Ligand/IonDIMETHYL SULFOXIDE
3FE1Ligand/IonFE (III) ION
4GOL1Ligand/IonGLYCEROL

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:56 , HIS A:58 , HIS A:101 , GLU A:103 , HOH A:406 , HOH A:560binding site for residue FE A 301
2AC2SOFTWAREGLY A:154 , GLU A:155 , GLN A:184 , TRP A:190 , HOH A:436 , HOH A:481 , HOH A:497 , HOH A:584binding site for residue GOL A 302
3AC3SOFTWAREGLU A:137 , GLU A:138 , ILE A:139 , PRO A:140binding site for residue DMS A 303
4AC4SOFTWARETYR A:164 , HOH A:492binding site for residue DMS A 304
5AC5SOFTWAREGLU A:18 , ARG A:26 , LEU A:41 , ASP A:43 , PHE A:45 , PHE A:53 , PRO A:54 , HIS A:56 , MET A:73 , GLU A:103 , GLY A:113 , LEU A:114 , GLN A:115 , TRP A:117 , HOH A:406binding site for residue 6JQ A 305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JCT)

(-) Cis Peptide Bonds  (2, 3)

Asymmetric/Biological Unit
No.Residues
1Asp A:37 -Pro A:38
2Arg A:49 -Pro A:50

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JCT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JCT)

(-) Exons   (0, 0)

(no "Exon" information available for 5JCT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:287
                                                                                                                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..eeee...eeeee...hhhhh....eeeeeeeee.....eeeeee..eeeeeee.....eeeee....eeee....eeeee....eeeeeee.....eeeeeeeee.hhhhh....eeeeehhhhh...ee..eeeeeee.ee..ee........eeeeeeee....eeeee.....eeeeeeee..eee......eee...eeeee....eeeee......eeeeeeee.......eee..eee.hhhhhhhhhhhhhh....hhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jct A   4 SKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN 290
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JCT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JCT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JCT)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6JQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:49 - Pro A:50   [ RasMol ]  
    Asp A:37 - Pro A:38   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jct
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PIR_HUMAN | O00625
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.13.11.24
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PIR_HUMAN | O00625
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PIR_HUMAN | O00625: 1j1l 3acl 4ero 4ewa 4ewd 4ewe 4gul 4hlt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5JCT)