|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 7) Biological Unit 1 (1, 1) Biological Unit 2 (2, 3) Biological Unit 3 (2, 3) |
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 1FSE) |
(no "Cis Peptide Bond" information available for 1FSE) |
(no "SAP(SNP)/Variant" information available for 1FSE) |
Asymmetric Unit (2, 7)
|
(no "Exon" information available for 1FSE) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:67 aligned with GERE_BACSU | P11470 from UniProtKB/Swiss-Prot Length:74 Alignment length:67 17 27 37 47 57 67 GERE_BACSU 8 SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 SCOP domains d1fsea_ A: Germination protein GerE SCOP domains CATH domains 1fseA00 A:8-74 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) HTH_LUXR_2 PDB: - UniProt: 5-70 ---- PROSITE (1) PROSITE (2) ------------------HTH_LUXR_1 PDB: A:26-53 --------------------- PROSITE (2) Transcript ------------------------------------------------------------------- Transcript 1fse A 8 SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 17 27 37 47 57 67 Chain B from PDB Type:PROTEIN Length:70 aligned with GERE_BACSU | P11470 from UniProtKB/Swiss-Prot Length:74 Alignment length:70 14 24 34 44 54 64 74 GERE_BACSU 5 EFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 SCOP domains d1fseb_ B: Germination protein GerE SCOP domains CATH domains 1fseB00 B:5-74 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) HTH_LUXR_2 PDB: B:5-70 UniProt: 5-70 ---- PROSITE (1) PROSITE (2) ---------------------HTH_LUXR_1 PDB: B:26-53 --------------------- PROSITE (2) Transcript ---------------------------------------------------------------------- Transcript 1fse B 5 EFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 14 24 34 44 54 64 74 Chain C from PDB Type:PROTEIN Length:67 aligned with GERE_BACSU | P11470 from UniProtKB/Swiss-Prot Length:74 Alignment length:67 17 27 37 47 57 67 GERE_BACSU 8 SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 SCOP domains d1fsec_ C: Germination protein GerE SCOP domains CATH domains 1fseC00 C:8-74 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) HTH_LUXR_2 PDB: - UniProt: 5-70 ---- PROSITE (1) PROSITE (2) ------------------HTH_LUXR_1 PDB: C:26-53 --------------------- PROSITE (2) Transcript ------------------------------------------------------------------- Transcript 1fse C 8 SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 17 27 37 47 57 67 Chain D from PDB Type:PROTEIN Length:66 aligned with GERE_BACSU | P11470 from UniProtKB/Swiss-Prot Length:74 Alignment length:66 18 28 38 48 58 68 GERE_BACSU 9 KPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 SCOP domains d1fsed_ D: Germination protein GerE SCOP domains CATH domains 1fseD00 D:9-74 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) HTH_LUXR_2 PDB: - UniProt: 5-70 ---- PROSITE (1) PROSITE (2) -----------------HTH_LUXR_1 PDB: D:26-53 --------------------- PROSITE (2) Transcript ------------------------------------------------------------------ Transcript 1fse D 9 KPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 18 28 38 48 58 68 Chain E from PDB Type:PROTEIN Length:64 aligned with GERE_BACSU | P11470 from UniProtKB/Swiss-Prot Length:74 Alignment length:64 20 30 40 50 60 70 GERE_BACSU 11 LLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 SCOP domains d1fsee_ E: Germination protein GerE SCOP domains CATH domains 1fseE00 E:11-74 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE (1) HTH_LUXR_2 PDB: - UniProt: 5-70 ---- PROSITE (1) PROSITE (2) ---------------HTH_LUXR_1 PDB: E:26-53 --------------------- PROSITE (2) Transcript ---------------------------------------------------------------- Transcript 1fse E 11 LLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 20 30 40 50 60 70 Chain F from PDB Type:PROTEIN Length:50 aligned with GERE_BACSU | P11470 from UniProtKB/Swiss-Prot Length:74 Alignment length:65 19 29 39 49 59 69 GERE_BACSU 10 PLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 SCOP domains d1fsef_ F: Germina tion protein GerE SCOP domains CATH domains 1fseF00 F:10-74 'w inged helix' repressor DNA bindi CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE (1) HTH_LUXR_2 PDB: - UniProt: 5-70 ---- PROSITE (1) PROSITE (2) ----------------HTH_LUXR_1 PDB: F:26-53 --------------------- PROSITE (2) Transcript ----------------------------------------------------------------- Transcript 1fse F 10 PLLTKREREVFELLVQDK---------------VRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 19 | - - | 49 59 69 27 43
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1FSE) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F (GERE_BACSU | P11470)
|
|
|
|
|
|
|