Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE SOLUTION STRUCTURES OF MUTANT CALBINDIN D9K'S, AS DETERMINED BY NMR, SHOW THAT THE CALCIUM BINDING SITE CAN ADOPT DIFFERENT FOLDS
 
Authors :  C. Johansson, M. Ullner, T. Drakenberg
Date :  23 Apr 93  (Deposition) - 31 Oct 93  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (29x)
Keywords :  Calcium-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Johansson, M. Ullner, T. Drakenberg
The Solution Structures Of Mutant Calbindin D9K'S, As Determined By Nmr, Show That The Calcium-Binding Site Can Adopt Different Folds.
Biochemistry V. 32 8429 1993
PubMed-ID: 8357794  |  Reference-DOI: 10.1021/BI00084A007
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALBINDIN D9K
    Chains: A
    Engineered: YES
    Organ: INTESTINE
    Organism Common: CATTLE
    Organism Scientific: BOS TAURUS
    Organism Taxid: 9913

 Structural Features

(-) Chains, Units

  
NMR Structure (29x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BOC)

(-) Sites  (2, 2)

NMR Structure (2, 2)
No.NameEvidenceResiduesDescription
1IUNKNOWNALA A:14 , ASP A:15 , LYS A:16 , GLU A:17 , GLY A:18 , ASP A:19 , GLY A:20 , ASN A:21 , GLN A:22 , LEU A:23 , SER A:24 , LYS A:25 , GLU A:26 , GLU A:27NULL
2IIUNKNOWNASP A:54 , LYS A:55 , ASN A:56 , GLY A:57 , ASP A:58 , GLY A:59 , GLU A:60 , VAL A:61 , SER A:62 , PHE A:63 , GLU A:64 , GLU A:65NULL

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BOC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BOC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BOC)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S100G_BOVIN45-79  1A:41-75
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S100G_BOVIN53-74  1A:49-70
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S100G_BOVIN58-70  1A:54-66

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000226301ENSBTAE00000325724Un.004.79:167452-16749746S100G_BOVIN-00--
1.2ENSBTAT000000226302ENSBTAE00000184836Un.004.79:168025-168168144S100G_BOVIN1-45451A:0-4142
1.3ENSBTAT000000226303ENSBTAE00000184843Un.004.79:171280-171540261S100G_BOVIN46-79341A:42-7534

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:76
 aligned with S100G_BOVIN | P02633 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:76
                                    13        23        33        43        53        63        73      
           S100G_BOVIN    4 KKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ 79
               SCOP domains d1boca_ A: Calbindin D9K                                                     SCOP domains
               CATH domains 1bocA00 A:0-75 EF-hand                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhh.hhhhhhh...eee...hhhhhhhhhhhhh......hhhhhh.......eee...hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------EF_HAND_2  PDB: A:41-75             PROSITE (1)
                PROSITE (2) -------------------------------------------------S100_CABP  PDB: A:49-7----- PROSITE (2)
                PROSITE (3) ------------------------------------------------------EF_HAND_1    --------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: A:0-41 UniProt: 1-45       Exon 1.3  PDB: A:42-75             Transcript 1
                  1boc A  0 MKSPEELKGIFEKYADKEGDGNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ 75
                                     9        19        29        39        49        59        69
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BOC)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (S100G_BOVIN | P02633)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005499    vitamin D binding    Interacting selectively and non-covalently with vitamin D, any of a group of related, fat-soluble compounds that are derived from delta-5,7 steroids and play a central role in calcium metabolism. Specific forms of vitamin D include calciferol (ergocalciferol; vitamin D2) and cholecalciferol (calciol; vitamin D3).
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1boc)
 
  Sites
    I  [ RasMol ]  +environment [ RasMol ]
    II  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1boc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1boc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S100G_BOVIN | P02633
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  S100G_BOVIN | P02633
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        S100G_BOVIN | P02633: 1b1g 1bod 1cdn 1clb 1d1o 1ht9 1ig5 1igv 1kcy 1kqv 1ksm 1n65 1qx2 1rt0 2bca 2bcb 2maz 3icb 4icb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BOC)