|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 4)
|
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 1HT9) |
(no "Cis Peptide Bond" information available for 1HT9) |
(no "SAP(SNP)/Variant" information available for 1HT9) |
Asymmetric/Biological Unit (3, 6)
|
Asymmetric/Biological Unit (2, 4)
|
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:76 aligned with S100G_BOVIN | P02633 from UniProtKB/Swiss-Prot Length:79 Alignment length:76 13 23 33 43 53 63 73 S100G_BOVIN 4 KKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ 79 SCOP domains d1ht9a_ A: Calbindin D9K SCOP domains CATH domains 1ht9A00 A:0-75 EF-hand CATH domains Pfam domains ---------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------EF_HAND_2 PDB: A:41-75 PROSITE (1) PROSITE (2) -------------------------------------------------S100_CABP PDB: A:49-7----- PROSITE (2) PROSITE (3) ------------------------------------------------------EF_HAND_1 --------- PROSITE (3) Transcript 1 Exon 1.2 PDB: A:0-41 UniProt: 1-45 Exon 1.3 PDB: A:42-75 Transcript 1 1ht9 A 0 MKSPEELKGIFEKYAAKEGDPNNLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ 75 9 19 29 39 49 59 69 Chain B from PDB Type:PROTEIN Length:76 aligned with S100G_BOVIN | P02633 from UniProtKB/Swiss-Prot Length:79 Alignment length:76 13 23 33 43 53 63 73 S100G_BOVIN 4 KKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ 79 SCOP domains d1ht9b_ B: Calbindin D9K SCOP domains CATH domains 1ht9B00 B:0-75 EF-hand CATH domains Pfam domains ---------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------EF_HAND_2 PDB: B:41-75 PROSITE (1) PROSITE (2) -------------------------------------------------S100_CABP PDB: B:49-7----- PROSITE (2) PROSITE (3) ------------------------------------------------------EF_HAND_1 --------- PROSITE (3) Transcript 1 Exon 1.2 PDB: B:0-41 UniProt: 1-45 Exon 1.3 PDB: B:42-75 Transcript 1 1ht9 B 0 MKSPEELKGIFEKYAAKEGDPNNLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ 75 9 19 29 39 49 59 69
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "Pfam Domain" information available for 1HT9) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (S100G_BOVIN | P02633)
|
|
|
|
|
|
|