|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1BJA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1BJA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1BJA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1BJA) |
Exons (0, 0)| (no "Exon" information available for 1BJA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:95 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot Length:211 Alignment length:95 11 21 31 41 51 61 71 81 91 MOTA_BPT4 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 SCOP domains d1bjaa_ A: Transcription factor MotA, activation domain SCOP domains CATH domains 1bjaA00 A:2-96 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1bja A 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 11 21 31 41 51 61 71 81 91 Chain B from PDB Type:PROTEIN Length:95 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot Length:211 Alignment length:95 11 21 31 41 51 61 71 81 91 MOTA_BPT4 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 SCOP domains d1bjab_ B: Transcription factor MotA, activation domain SCOP domains CATH domains 1bjaB00 B:2-96 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1bja B 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 11 21 31 41 51 61 71 81 91
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1BJA) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A,B (MOTA_BPT4 | P22915)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|