![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 1BJA) |
(no "Cis Peptide Bond" information available for 1BJA) |
(no "SAP(SNP)/Variant" information available for 1BJA) |
(no "PROSITE Motif" information available for 1BJA) |
(no "Exon" information available for 1BJA) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:95 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot Length:211 Alignment length:95 11 21 31 41 51 61 71 81 91 MOTA_BPT4 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 SCOP domains d1bjaa_ A: Transcription factor MotA, activation domain SCOP domains CATH domains 1bjaA00 A:2-96 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1bja A 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 11 21 31 41 51 61 71 81 91 Chain B from PDB Type:PROTEIN Length:95 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot Length:211 Alignment length:95 11 21 31 41 51 61 71 81 91 MOTA_BPT4 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 SCOP domains d1bjab_ B: Transcription factor MotA, activation domain SCOP domains CATH domains 1bjaB00 B:2-96 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1bja B 2 SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK 96 11 21 31 41 51 61 71 81 91
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1BJA) |
Asymmetric Unit(hide GO term definitions) Chain A,B (MOTA_BPT4 | P22915)
|
|
|
|
|
|
|