Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  DNA BINDING DOMAIN OF THE PHAGE T4 TRANSCRIPTION FACTOR MOTA (AA105-211)
 
Authors :  N. Li, E. A. Sickmier, R. Zhang, A. Joachimiak, S. W. White
Date :  01 Nov 01  (Deposition) - 21 Nov 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Keywords :  Escherichia Coli; X-Ray Crystallography; Protein-Dna Interactions; Structural Genomics; Eubacterial Promoters. , Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Li, E. A. Sickmier, R. Zhang, A. Joachimiak, S. W. White
The Mota Transcription Factor From Bacteriophage T4 Contains A Novel Dna-Binding Domain: The 'Double Wing' Motif.
Mol. Microbiol. V. 43 1079 2002
PubMed-ID: 11918797  |  Reference-DOI: 10.1046/J.1365-2958.2002.02809.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSCRIPTION REGULATORY PROTEIN MOTA
    ChainsA, B, C, D, E, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET13A
    Expression System StrainBL21 DE3
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentDNA BINDING DOMAIN RESIDUES 105-211
    GeneMOTA
    Organism ScientificENTEROBACTERIA PHAGE T4
    Organism Taxid10665

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A     
Biological Unit 2 (1x) B    
Biological Unit 3 (1x)  C   
Biological Unit 4 (1x)   D  
Biological Unit 5 (1x)    E 
Biological Unit 6 (1x)     F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KAF)

(-) Sites  (0, 0)

(no "Site" information available for 1KAF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KAF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KAF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KAF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KAF)

(-) Exons   (0, 0)

(no "Exon" information available for 1KAF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:108
 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:108
                                   113       123       133       143       153       163       173       183       193       203        
            MOTA_BPT4   104 REITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
               SCOP domains d1kafa_ A: DNA-binding C-terminal domain of the transcription factor MotA                                    SCOP domains
               CATH domains 1kafA00 A:104-211 DNA-binding domain of the transcription factor MotA                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...eeeeeee..eeeeeeeeee..eeeeee....eeeeeee..hhhhhhhhhh...eeee....eeeeeee.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1kaf A 104 MEITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
                                   113       123       133       143       153       163       173       183       193       203        

Chain B from PDB  Type:PROTEIN  Length:108
 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:108
                                   113       123       133       143       153       163       173       183       193       203        
            MOTA_BPT4   104 REITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
               SCOP domains d1kafb_ B: DNA-binding C-terminal domain of the transcription factor MotA                                    SCOP domains
               CATH domains 1kafB00 B:104-211 DNA-binding domain of the transcription factor MotA                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...eeeeeee..eeeeeeeeee..eeeeee....eeeeeee..hhhhhhhhhhh..eeee....eeeeeee.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1kaf B 104 MEITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
                                   113       123       133       143       153       163       173       183       193       203        

Chain C from PDB  Type:PROTEIN  Length:108
 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:108
                                   113       123       133       143       153       163       173       183       193       203        
            MOTA_BPT4   104 REITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
               SCOP domains d1kafc_ C: DNA-binding C-terminal domain of the transcription factor MotA                                    SCOP domains
               CATH domains 1kafC00 C:104-211 DNA-binding domain of the transcription factor MotA                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...eeeeeee..eeeeeeeeee..eeeeee....eeeeeee..hhhhhhhhhhh..eeee....eeeeeee.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1kaf C 104 MEITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
                                   113       123       133       143       153       163       173       183       193       203        

Chain D from PDB  Type:PROTEIN  Length:104
 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:104
                                   117       127       137       147       157       167       177       187       197       207    
            MOTA_BPT4   108 SDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
               SCOP domains d1kafd_ D: DNA-binding C-terminal domain of the transcription factor MotA                                SCOP domains
               CATH domains 1kafD00 D:108-211 DNA-binding domain of the transcription factor MotA                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh...eeeeee...eeeeeeeeee..eeeeeee...eeeeeee..hhhhhhhhhhh..eeee....eeeeeee.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 1kaf D 108 SDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
                                   117       127       137       147       157       167       177       187       197       207    

Chain E from PDB  Type:PROTEIN  Length:103
 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:103
                                   118       128       138       148       158       168       178       188       198       208   
            MOTA_BPT4   109 DMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
               SCOP domains d1kafe_ E: DNA-binding C-terminal domain of the transcription factor MotA                               SCOP domains
               CATH domains 1kafE00 E:109-211 DNA-binding domain of the transcription factor MotA                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh...eeeeee...eeeeeeeeee..eeeeeee...eeeeeee..hhhhhhhhhh...eeee....eeeeeee.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1kaf E 109 DMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
                                   118       128       138       148       158       168       178       188       198       208   

Chain F from PDB  Type:PROTEIN  Length:104
 aligned with MOTA_BPT4 | P22915 from UniProtKB/Swiss-Prot  Length:211

    Alignment length:104
                                   117       127       137       147       157       167       177       187       197       207    
            MOTA_BPT4   108 SDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
               SCOP domains d1kaff_ F: DNA-binding C-terminal domain of the transcription factor MotA                                SCOP domains
               CATH domains 1kafF00 F:108-211 DNA-binding domain of the transcription factor MotA                                    CATH domains
           Pfam domains (1) MotCF-1kafF01 F:108-208                                                                              --- Pfam domains (1)
           Pfam domains (2) MotCF-1kafF02 F:108-208                                                                              --- Pfam domains (2)
           Pfam domains (3) MotCF-1kafF03 F:108-208                                                                              --- Pfam domains (3)
           Pfam domains (4) MotCF-1kafF04 F:108-208                                                                              --- Pfam domains (4)
           Pfam domains (5) MotCF-1kafF05 F:108-208                                                                              --- Pfam domains (5)
           Pfam domains (6) MotCF-1kafF06 F:108-208                                                                              --- Pfam domains (6)
         Sec.struct. author hhhhhhhhhhhhhhhhh...eeeeeee..eeeeeeeeee..eeeeeee...eeeeeee..hhhhhhhhhhh..eeee....eeeeeee.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 1kaf F 108 SDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL 211
                                   117       127       137       147       157       167       177       187       197       207    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit

(-) CATH Domains  (1, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 6)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (MOTA_BPT4 | P22915)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kaf)
 
  Sites
(no "Sites" information available for 1kaf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kaf)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kaf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MOTA_BPT4 | P22915
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MOTA_BPT4 | P22915
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MOTA_BPT4 | P229151bja 1i1s 5jlt

(-) Related Entries Specified in the PDB File

1bja ACTIVATION DOMAIN OF THE PHAGE T4 TRANSCRIPTION FACTOR MOTA
1i1s SOLUTION STRUCTURE OF THE TRANSCRIPTIONAL ACTIVATION DOMAIN OF THE BACTERIOPHAGE T4 PROTEIN MOTA