1AUI - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HUMAN CALCINEURIN HETERODIMER

Authors :   C. R. Kissinger, H. E. Parge, D. R. Knighton, L. A. Pelletier, C. T. Lewis A. Tempczyk, J. E. Villafranca

Date :   27 Aug 97 (Deposition) - 03 Dec 97 (Release) - 29 Feb 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A,B

Keywords :   Hydrolase, Phosphatase, Immunosuppression (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. R. Kissinger, H. E. Parge, D. R. Knighton, C. T. Lewis, L. A. Pelletier, A. Tempczyk, V. J. Kalish, K. D. Tucker, R. E. Showalter, E. W. Moomaw, L. N. Gastinel, N. Habuka, X. Chen, F. Maldonado, J. E. Barker, R. Bacquet, J. E. Villafranca
Crystal Structures Of Human Calcineurin And The Human Fkbp12-Fk506-Calcineurin Complex.
Nature V. 378 641 1995
PubMed-ID: 8524402 | Reference-DOI: 10.1038/378641A0

Molecule 1 - SERINE/THREONINE PHOSPHATASE 2B
	Chains	:	A
	EC Number	:	3.1.3.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CALCINEURIN

Molecule 2 - SERINE/THREONINE PHOSPHATASE 2B
	Chains	:	B
	EC Number	:	3.1.3.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CALCINEURIN

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 6)

No.	Name	Count	Type	Full Name
1	CA	4	Ligand/Ion	CALCIUM ION
2	FE	1	Ligand/Ion	FE (III) ION
3	ZN	1	Ligand/Ion	ZINC ION

Asymmetric Unit (12, 12)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP B:30 , ASP B:32 , SER B:34 , SER B:36 , GLU B:41	BINDING SITE FOR RESIDUE CA B 500
02	AC2	SOFTWARE	ASP B:62 , ASP B:64 , ASN B:66 , GLU B:68 , GLU B:73 , HOH B:585	BINDING SITE FOR RESIDUE CA B 501
03	AC3	SOFTWARE	ASP B:99 , ASP B:101 , ASP B:103 , TYR B:105 , GLU B:110 , HOH B:755	BINDING SITE FOR RESIDUE CA B 502
04	AC4	SOFTWARE	ASP B:140 , ASP B:142 , ASP B:144 , ARG B:146 , GLU B:151 , HOH B:622	BINDING SITE FOR RESIDUE CA B 503
05	AC5	SOFTWARE	ASP A:118 , ASN A:150 , HIS A:199 , HIS A:281 , FE A:523 , HOH A:778	BINDING SITE FOR RESIDUE ZN A 522
06	AC6	SOFTWARE	ASP A:90 , HIS A:92 , ASP A:118 , ZN A:522 , HOH A:627 , HOH A:778 , HOH A:796	BINDING SITE FOR RESIDUE FE A 523
07	CA1	UNKNOWN	ASP B:30 , ASP B:32 , SER B:34 , SER B:36 , GLU B:41	CALCIUM BINDING SITE.
08	CA2	UNKNOWN	ASP B:62 , ASP B:64 , ASN B:66 , GLU B:68 , GLU B:73	CALCIUM BINDING SITE.
09	CA3	UNKNOWN	ASP B:99 , ASP B:101 , ASP B:103 , TYR B:105 , GLU B:110	CALCIUM BINDING SITE.
10	CA4	UNKNOWN	ASP B:140 , ASP B:142 , ASP B:144 , ARG B:146 , GLU B:151	CALCIUM BINDING SITE.
11	FEB	UNKNOWN	ASP A:90 , HIS A:92 , ASP A:118	FE BINDING SITE.
12	ZNB	UNKNOWN	ASP A:118 , ASN A:150 , HIS A:199 , HIS A:281	ZN BINDING SITE.

(no "SS Bond" information available for 1AUI)

Asymmetric/Biological Unit

No.	Residues
1	Ala A:83	-	Pro A:84

(no "SAP(SNP)/Variant" information available for 1AUI)

Asymmetric/Biological Unit (3, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	CANB1_HUMAN	31-43 63-75 100-112 141-153	4	B:30-42 B:62-74 B:99-111 B:140-152
2	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	CANB1_HUMAN	50-85 18-46 87-122 128-163	4	B:49-84 B:17-45 B:86-121 B:127-162
3	SER_THR_PHOSPHATASE	PS00125	Serine/threonine specific protein phosphatases signature.	PP2BA_HUMAN	147-152	1	A:147-152

Asymmetric/Biological Unit (16, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.4	ENST00000234310	4	ENSE00001191356	chr2:68479663-68479257	407	CANB1_HUMAN	1-1	1	0	-	-
1.6	ENST00000234310	6	ENSE00001806348	chr2:68444263-68444224	40	CANB1_HUMAN	2-15	14	1	B:5-14	10
1.7	ENST00000234310	7	ENSE00001434958	chr2:68415822-68415646	177	CANB1_HUMAN	15-74	60	1	B:14-73	60
1.8	ENST00000234310	8	ENSE00000758788	chr2:68414446-68414387	60	CANB1_HUMAN	74-94	21	1	B:73-93	21
1.9	ENST00000234310	9	ENSE00000810241	chr2:68413784-68413600	185	CANB1_HUMAN	94-155	62	1	B:93-154	62
1.10c	ENST00000234310	10c	ENSE00001191364	chr2:68408142-68405989	2154	CANB1_HUMAN	156-170	15	1	B:155-169	15

2.2b	ENST00000394854	2b	ENSE00001896251	chr4:102268637-102267896	742	PP2BA_HUMAN	1-20	20	1	A:14-20	7
2.3a	ENST00000394854	3a	ENSE00000934976	chr4:102117273-102117073	201	PP2BA_HUMAN	20-87	68	1	A:20-87	68
2.6	ENST00000394854	6	ENSE00000970132	chr4:102030235-102030111	125	PP2BA_HUMAN	87-128	42	1	A:87-128	42
2.8	ENST00000394854	8	ENSE00001628359	chr4:102020879-102020768	112	PP2BA_HUMAN	129-166	38	1	A:129-166	38
2.9c	ENST00000394854	9c	ENSE00000970134	chr4:102019669-102019524	146	PP2BA_HUMAN	166-214	49	1	A:166-214	49
2.10b	ENST00000394854	10b	ENSE00001080696	chr4:102015072-102014933	140	PP2BA_HUMAN	215-261	47	1	A:215-261	47
2.11b	ENST00000394854	11b	ENSE00001720711	chr4:102004420-102004343	78	PP2BA_HUMAN	261-287	27	1	A:261-287	27
2.12	ENST00000394854	12	ENSE00000970136	chr4:102001783-102001689	95	PP2BA_HUMAN	287-319	33	1	A:287-319	33
2.13	ENST00000394854	13	ENSE00001781830	chr4:101984514-101984389	126	PP2BA_HUMAN	319-361	43	1	A:319-361	43
2.14	ENST00000394854	14	ENSE00001080697	chr4:101982318-101982244	75	PP2BA_HUMAN	361-386	26	1	A:361-373	13
2.15	ENST00000394854	15	ENSE00001080695	chr4:101961723-101961639	85	PP2BA_HUMAN	386-414	29	0	-	-
2.16	ENST00000394854	16	ENSE00000934972	chr4:101953521-101953424	98	PP2BA_HUMAN	414-447	34	0	-	-
2.17	ENST00000394854	17	ENSE00001797567	chr4:101950352-101950323	30	PP2BA_HUMAN	447-457	11	0	-	-
2.18e	ENST00000394854	18e	ENSE00001284009	chr4:101947218-101944587	2632	PP2BA_HUMAN	457-521	65	1	A:469-486	18

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:378
 aligned with PP2BA_HUMAN | Q08209 from UniProtKB/Swiss-Prot  Length:521

    Alignment length:473
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483   
          PP2BA_HUMAN    14 TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPR 486
               SCOP domains d1auia_ A: Protein phosphatase-2B (PP-2B, calcineurin A subunit)                                                                                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1auiA00 A:14-486  [code=3.60.21.10, no name defined]                                                                                                                                                                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhh........hhhhhhhhhh.....hhhhhhhhhhhhhhhh....eeee...eeee......hhhhhhhhhhh.......eee..........hhhhhhhhhhhhhh....eee.......hhhhhh..hhhhhhhh..hhhhhhhhhhhhh...eeee...eeee..........hhhhhh...........hhhhhhh...............eee.......eee.hhhhhhhhhh....eeee........eee...........eeee.....hhh.....eeeeeee..eeeeeee.........hhh..hhhhhhhhhhhhhhhhhhhhhhh..-----------------------------------------------------------------------------------------------.hhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------SER_TH---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
           Transcript 2 (1) 2.2b   ------------------------------------------------------------------Exon 2.6  PDB: A:87-128 UniProt: 87-128   Exon 2.8  PDB: A:129-166              ------------------------------------------------Exon 2.10b  PDB: A:215-261 UniProt: 215-261    -------------------------Exon 2.12  PDB: A:287-319        -----------------------------------------Exon 2.14  PDB: A:361-373 ---------------------------Exon 2.16  PDB: - UniProt: 414-447---------Exon 2.18e  PDB: A:469-486     Transcript 2 (1)
           Transcript 2 (2) ------Exon 2.3a  PDB: A:20-87 UniProt: 20-87                              ------------------------------------------------------------------------------Exon 2.9c  PDB: A:166-214 UniProt: 166-214       ----------------------------------------------Exon 2.11b  PDB: A:261-287 -------------------------------Exon 2.13  PDB: A:319-361 UniProt: 319-361 ------------------------Exon 2.15  PDB: -            --------------------------------Exon 2.17  ----------------------------- Transcript 2 (2)
                 1aui A  14 TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICS-----------------------------------------------------------------------------------------------SFEEAKGLDRINERMPPR 486
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373         -         -         -         -         -         -         -         -         -     | 473       483   
                                                                                                                                                                                                                                                                                                                                                                                                 373                                                                                             469

Chain B from PDB  Type:PROTEIN  Length:165
 aligned with CANB1_HUMAN | P63098 from UniProtKB/Swiss-Prot  Length:170

    Alignment length:165
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165     
          CANB1_HUMAN     6 SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170
               SCOP domains d1auib_ B: Calcineurin regulatory subunit (B-chain)                                                                                                                   SCOP domains
               CATH domains 1auiB00 B:5-169 EF-hand                                                                                                                                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhh.........hhhh...hhhhh...hhhhhhhh.........hhhhhhhhhhh.....hhhhhhhhhhhh.........hhhhhhhhhhhh.....hhhhhhhhhhhhhhh.........hhhhhhhhhhh.hhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------EF_HAND_1    -------------------EF_HAND_1    ------------------------EF_HAND_1    ----------------------------EF_HAND_1    ----------------- PROSITE (1)
                PROSITE (2) ------------EF_HAND_2  PDB: B:17-45      ---EF_HAND_2  PDB: B:49-84             -EF_HAND_2  PDB: B:86-121            -----EF_HAND_2  PDB: B:127-162           ------- PROSITE (2)
           Transcript 1 (1) Exon 1.6  ----------------------------------------------------------Exon 1.8  PDB: B:73-9-------------------------------------------------------------Exon 1.10c      Transcript 1 (1)
           Transcript 1 (2) ---------Exon 1.7  PDB: B:14-73 UniProt: 15-74                       -------------------Exon 1.9  PDB: B:93-154 UniProt: 94-155                       --------------- Transcript 1 (2)
                 1aui B   5 SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 169
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 4-Layer Sandwich (459)

Topology: Purple Acid Phosphatase; chain A, domain 2 (87)

Homologous Superfamily: [code=3.60.21.10, no name defined] (83)

Human (Homo sapiens) (36)

1auiA00

A:14-486

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Recoverin; domain 1 (474)

Homologous Superfamily: EF-hand (412)

Human (Homo sapiens) (106)

1auiB00

B:5-169

(no "Pfam Domain" information available for 1AUI)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PP2BA_HUMAN | Q08209)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004723	calcium-dependent protein serine/threonine phosphatase activity	Catalysis of the reactions: protein serine phosphate + H2O = protein serine + phosphate; and protein threonine phosphate + H2O = protein threonine + phosphate. These reactions require the presence of calcium ions.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0033192	calmodulin-dependent protein phosphatase activity	Catalysis of the reaction: protein serine/threonine phosphate + H2O = protein serine/threonine + phosphate, dependent on the presence of calcium-bound calmodulin.
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
biological process
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0042110	T cell activation	The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0007223	Wnt signaling pathway, calcium modulating pathway	The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors leads to an increase in intracellular calcium and activation of protein kinase C (PKC).
	GO:0033173	calcineurin-NFAT signaling cascade	Any intracellular signal transduction in which the signal is passed on within the cell by activation of a member of the NFAT protein family as a consequence of NFAT dephosphorylation by Ca(2+)-activated calcineurin. The cascade begins with calcium-dependent activation of the phosphatase calcineurin. Calcineurin dephosphorylates multiple phosphoserine residues on NFAT, resulting in the translocation of NFAT to the nucleus. The cascade ends with regulation of transcription by NFAT. The calcineurin-NFAT cascade lies downstream of many cell surface receptors, including G-protein coupled receptors (GPCRs) and receptor tyrosine kinases (RTKs) that signal to mobilize calcium ions (Ca2+).
	GO:0006816	calcium ion transport	The directed movement of calcium (Ca) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0019722	calcium-mediated signaling	Any intracellular signal transduction in which the signal is passed on within the cell via calcium ions.
	GO:0014898	cardiac muscle hypertrophy in response to stress	The physiological enlargement or overgrowth of all or part of the heart muscle due to an increase in size (not length) of individual cardiac muscle fibers, without cell division, as a result of a disturbance in organismal or cellular homeostasis.
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0071333	cellular response to glucose stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0060079	excitatory postsynaptic potential	A process that leads to a temporary increase in postsynaptic potential due to the flow of positively charged ions into the postsynaptic cell. The flow of ions that causes an EPSP is an excitatory postsynaptic current (EPSC) and makes it easier for the neuron to fire an action potential.
	GO:0050804	modulation of chemical synaptic transmission	Any process that modulates the frequency or amplitude of synaptic transmission, the process of communication from a neuron to a target (neuron, muscle, or secretory cell) across a synapse. Amplitude, in this case, refers to the change in postsynaptic membrane potential due to a single instance of synaptic transmission.
	GO:0033555	multicellular organismal response to stress	Any process that results in a change in state or activity of a multicellular organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating the organism is under stress. The stress is usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
	GO:0035562	negative regulation of chromatin binding	Any process that stops or reduces the frequency, rate or extent of chromatin binding. Chromatin binding is the selective interaction with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0050774	negative regulation of dendrite morphogenesis	Any process that stops, prevents, or reduces the frequency, rate or extent of dendrite morphogenesis.
	GO:0046676	negative regulation of insulin secretion	Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of insulin.
	GO:0051533	positive regulation of NFAT protein import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of an NFAT protein from the cytoplasm to the nucleus.
	GO:1903244	positive regulation of cardiac muscle hypertrophy in response to stress	Any process that activates or increases the frequency, rate or extent of cardiac muscle hypertrophy in response to stress.
	GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0001975	response to amphetamine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amphetamine stimulus. Amphetamines consist of a group of compounds related to alpha-methylphenethylamine.
	GO:0051592	response to calcium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0048741	skeletal muscle fiber development	The process whose specific outcome is the progression of the skeletal muscle fiber over time, from its formation to the mature structure. Muscle fibers are formed by the maturation of myotubes. They can be classed as slow, intermediate/fast or fast.
	GO:0014883	transition between fast and slow fiber	The process of conversion of fast-contracting muscle fibers to a slower character. This may involve slowing of contractile rate, slow myosin gene induction, increase in oxidative metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0005955	calcineurin complex	A heterodimeric calcium ion and calmodulin dependent protein phosphatase composed of catalytic and regulatory subunits; the regulatory subunit is very similar in sequence to calmodulin.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0098794	postsynapse	The part of a synapse that is part of the post-synaptic cell.
	GO:0042383	sarcolemma	The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.

Chain B (CANB1_HUMAN | P63098)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004723	calcium-dependent protein serine/threonine phosphatase activity	Catalysis of the reactions: protein serine phosphate + H2O = protein serine + phosphate; and protein threonine phosphate + H2O = protein threonine + phosphate. These reactions require the presence of calcium ions.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0007223	Wnt signaling pathway, calcium modulating pathway	The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors leads to an increase in intracellular calcium and activation of protein kinase C (PKC).
	GO:0033173	calcineurin-NFAT signaling cascade	Any intracellular signal transduction in which the signal is passed on within the cell by activation of a member of the NFAT protein family as a consequence of NFAT dephosphorylation by Ca(2+)-activated calcineurin. The cascade begins with calcium-dependent activation of the phosphatase calcineurin. Calcineurin dephosphorylates multiple phosphoserine residues on NFAT, resulting in the translocation of NFAT to the nucleus. The cascade ends with regulation of transcription by NFAT. The calcineurin-NFAT cascade lies downstream of many cell surface receptors, including G-protein coupled receptors (GPCRs) and receptor tyrosine kinases (RTKs) that signal to mobilize calcium ions (Ca2+).
	GO:0051533	positive regulation of NFAT protein import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of an NFAT protein from the cytoplasm to the nucleus.
	GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
cellular component
	GO:0005955	calcineurin complex	A heterodimeric calcium ion and calmodulin dependent protein phosphatase composed of catalytic and regulatory subunits; the regulatory subunit is very similar in sequence to calmodulin.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0042383	sarcolemma	The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		CA1	[ RasMol ]	+environment [ RasMol ]
		CA2	[ RasMol ]	+environment [ RasMol ]
		CA3	[ RasMol ]	+environment [ RasMol ]
		CA4	[ RasMol ]	+environment [ RasMol ]
		FEB	[ RasMol ]	+environment [ RasMol ]
		ZNB	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:83 - Pro A:84	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Molmol
	protein, nucleic acid: cartoon; ligands: spacefill; active site: sticks [ mono GIF format \| stereo GIF format ] (automatic, in case of more than 1 NMR structures only model 1 is shown)
Prepi
	ribbon, secondary structure, active sites, chain-specific coloring [ mono GIF format \| stereo GIF format ]
	C alpha wire, labeling, active sites, chain-specific coloring, sequence [ mono GIF format \| stereo GIF format ]
	active sites only [ mono GIF format \| stereo GIF format ]
	spacefill, chain-specific coloring [ mono GIF format \| stereo GIF format ]

Access by PDB/NDB ID
	1aui
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CANB1_HUMAN \| P63098
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PP2BA_HUMAN \| Q08209
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CANB1_HUMAN \| P63098
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PP2BA_HUMAN \| Q08209
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1AUI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 9)

Exons (16, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (53, 72)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File