Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  BACTERIOPHAGE MS2 CAPSID PROTEIN/RNA COMPLEX
 
Authors :  S. Van Den Worm, N. Stonehouse, K. Valegard, L. Liljas
Date :  06 Aug 97  (Deposition) - 24 Dec 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,R,S
Biol. Unit 1:  A,B,C,R,S  (60x)
Keywords :  Complex (Coat Protein/Rna), Coat Protein, Rna-Binding, Viral Protein Capsid, Rna Fragment, Icosahedral Virus, Virus/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. H. Van Den Worm, N. J. Stonehouse, K. Valegard, J. B. Murray, C. Walton, K. Fridborg, P. G. Stockley, L. Liljas
Crystal Structures Of Ms2 Coat Protein Mutants In Complex With Wild-Type Rna Operator Fragments.
Nucleic Acids Res. V. 26 1345 1998
PubMed-ID: 9469847  |  Reference-DOI: 10.1093/NAR/26.5.1345
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (BACTERIOPHAGE MS2 COAT PROTEIN)
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    MutationYES
    Organism ScientificENTEROBACTERIO PHAGE MS2
    Organism Taxid12022
 
Molecule 2 - RNA (5'- R(*AP*CP*AP*UP*GP*AP*GP*GP*AP*UP*UP*AP*CP*CP*CP*AP*U P*GP*U)-3')
    ChainsR, S
    EngineeredYES
    FragmentREPLICASE OPERATOR HAIRPIN, 19 NUCLEOTIDES
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345
Asymmetric Unit ABCRS
Biological Unit 1 (60x)ABCRS

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AQ3)

(-) Sites  (0, 0)

(no "Site" information available for 1AQ3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1AQ3)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Leu B:77 -Pro B:78

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AQ3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1AQ3)

(-) Exons   (0, 0)

(no "Exon" information available for 1AQ3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:129
 aligned with CAPSD_BPMS2 | P03612 from UniProtKB/Swiss-Prot  Length:130

    Alignment length:129
                                    11        21        31        41        51        61        71        81        91       101       111       121         
          CAPSD_BPMS2     2 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 130
               SCOP domains d1aq3a_ A: MS2 virus coat protein                                                                                                 SCOP domains
               CATH domains 1aq3A00 A:1-129 MS2 Viral Coat Protein                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeee.hhh.eeeee........eeeeeee.....eeeeeeeeeeeeeeeeee..eeeeeeeeeeeeeeeeeee....hhhhhhhhhhhhhh.....hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aq3 A   1 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYSIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

Chain B from PDB  Type:PROTEIN  Length:129
 aligned with CAPSD_BPMS2 | P03612 from UniProtKB/Swiss-Prot  Length:130

    Alignment length:129
                                    11        21        31        41        51        61        71        81        91       101       111       121         
          CAPSD_BPMS2     2 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 130
               SCOP domains d1aq3b_ B: MS2 virus coat protein                                                                                                 SCOP domains
               CATH domains 1aq3B00 B:1-129 MS2 Viral Coat Protein                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeee.hhh.eeee.........eeeeeee.....eeeeeeeeeee.............hhh.eeeeeeeeeee....hhhhhhhhhhhhhh.....hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aq3 B   1 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYSIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

Chain C from PDB  Type:PROTEIN  Length:129
 aligned with CAPSD_BPMS2 | P03612 from UniProtKB/Swiss-Prot  Length:130

    Alignment length:129
                                    11        21        31        41        51        61        71        81        91       101       111       121         
          CAPSD_BPMS2     2 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 130
               SCOP domains d1aq3c_ C: MS2 virus coat protein                                                                                                 SCOP domains
               CATH domains 1aq3C00 C:1-129 MS2 Viral Coat Protein                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeee.hhh.eeeee........eeeeeeee....eeeeeeeeeeeeeeeeee..eeeeeeeeeeeeeeeeeee....hhhhhhhhhhhhhh.....hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aq3 C   1 ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYSIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

Chain R from PDB  Type:RNA  Length:16
                                                
                 1aq3 R   3 AUGAGGAUUACCCAUG  18
                                    12      

Chain S from PDB  Type:RNA  Length:12
                                            
                 1aq3 S   4 UGAGGAUUACCC  15
                                    13  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (1, 3)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AQ3)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (CAPSD_BPMS2 | P03612)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
    GO:0039617    T=3 icosahedral viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles where the subunits (capsomeres) are arranged to form an icosahedron with T=3 symmetry. The T=3 capsid is composed of 12 pentameric and 20 hexameric capsomeres.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aq3)
 
  Sites
(no "Sites" information available for 1aq3)
 
  Cis Peptide Bonds
    Leu B:77 - Pro B:78   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Molmol
  protein, nucleic acid: cartoon; ligands: spacefill; active site: sticks
Weblab
  protein: ribbon, secondary structure; RNA: ribbon, sticks; white background

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aq3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAPSD_BPMS2 | P03612
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CAPSD_BPMS2 | P03612
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAPSD_BPMS2 | P036121aq4 1bms 1msc 1mst 1mva 1mvb 1u1y 1zdh 1zdi 1zdj 1zdk 1zse 2b2d 2b2e 2b2g 2bny 2bq5 2bs0 2bs1 2bu1 2c4q 2c4y 2c4z 2c50 2c51 2iz8 2iz9 2izm 2izn 2ms2 2vtu 2wbh 4bp7 4zor 5msf 5tc1 6msf 7msf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AQ3)