Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ERYTHRINA CRISTAGALLI LECTIN
 
Authors :  K. Turton, R. Natesh, N. Thiyagarajan, J. A. Chaddock, K. R. Acharya
Date :  21 Mar 04  (Deposition) - 22 Jun 04  (Release) - 06 Oct 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Lectin, Non-Canonical Dimer, Carbohydrate-Binding, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Turton, R. Natesh, N. Thiyagarajan, J. A. Chaddock, K. R. Acharya
Crystal Structures Of Erythrina Cristagalli Lectin With Bound N-Linked Oligosaccharide And Lactose
Glycobiology V. 14 923 2004
PubMed-ID: 15201215  |  Reference-DOI: 10.1093/GLYCOB/CWH114

(-) Compounds

Molecule 1 - LECTIN (ECL)
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMTL1015
    Expression System Taxid: 562
    Organism Common: COCKSPUR CORAL TREE
    Organism Scientific: ERYTHRINA CRISTA-GALLI
    Organism Taxid: 49817
    Other Details: LEGUME SEEDS

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 12)

Asymmetric Unit (3, 12)
No.NameCountTypeFull Name
1CA4Ligand/IonCALCIUM ION
2LAT4Ligand/IonBETA-LACTOSE
3MN4Ligand/IonMANGANESE (II) ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2LAT2Ligand/IonBETA-LACTOSE
3MN-1Ligand/IonMANGANESE (II) ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2LAT2Ligand/IonBETA-LACTOSE
3MN-1Ligand/IonMANGANESE (II) ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:89 , GLY A:107 , PHE A:131 , ASN A:133 , GLY A:217 , ALA A:218 , GLN A:219 , ALA A:222 , HOH A:2185 , HOH A:2290 , HOH A:2291 , HOH A:2292 , HOH A:2293 , HOH A:2294BINDING SITE FOR RESIDUE LAT A1240
02AC2SOFTWAREASP B:89 , GLY B:107 , PHE B:131 , ASN B:133 , GLY B:217 , ALA B:218 , GLN B:219 , ALA B:222 , HOH B:2103 , HOH B:2221BINDING SITE FOR RESIDUE LAT B1240
03AC3SOFTWAREASP C:89 , GLY C:107 , PHE C:131 , ASN C:133 , GLY C:217 , ALA C:218 , GLN C:219 , ALA C:222 , HOH C:2226 , HOH C:2325 , HOH C:2326 , HOH C:2327 , HOH C:2328BINDING SITE FOR RESIDUE LAT C1240
04AC4SOFTWAREASP D:89 , GLY D:107 , PHE D:131 , ASN D:133 , GLY D:217 , ALA D:218 , GLN D:219 , ALA D:222 , HOH D:2150 , HOH D:2167 , HOH D:2262 , HOH D:2264 , HOH D:2265 , HOH D:2266 , HOH D:2267 , HOH D:2268BINDING SITE FOR RESIDUE LAT D1240
05AC5SOFTWAREGLU A:127 , ASP A:129 , ASP A:136 , HIS A:142 , HOH A:2295 , HOH A:2296BINDING SITE FOR RESIDUE MN A1241
06AC6SOFTWAREASP A:129 , PHE A:131 , ASN A:133 , ASP A:136 , HOH A:2149 , HOH A:2162BINDING SITE FOR RESIDUE CA A1242
07AC7SOFTWAREGLU B:127 , ASP B:129 , ASP B:136 , HIS B:142 , HOH B:2222 , HOH B:2223BINDING SITE FOR RESIDUE MN B1241
08AC8SOFTWAREASP B:129 , PHE B:131 , ASN B:133 , ASP B:136 , HOH B:2105 , HOH B:2118BINDING SITE FOR RESIDUE CA B1242
09AC9SOFTWAREGLU C:127 , ASP C:129 , ASP C:136 , HIS C:142 , HOH C:2329 , HOH C:2330BINDING SITE FOR RESIDUE MN C1241
10BC1SOFTWAREASP C:129 , PHE C:131 , ASN C:133 , ASP C:136 , HOH C:2181 , HOH C:2196BINDING SITE FOR RESIDUE CA C1242
11BC2SOFTWAREGLU D:127 , ASP D:129 , ASP D:136 , HIS D:142 , HOH D:2269 , HOH D:2270BINDING SITE FOR RESIDUE MN D1241
12BC3SOFTWAREASP D:129 , PHE D:131 , ASN D:133 , ASP D:136 , HOH D:2136 , HOH D:2149BINDING SITE FOR RESIDUE CA D1242

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1V00)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Arg A:84 -Pro A:85
2Ala A:88 -Asp A:89
3Val A:140 -Pro A:141
4Arg B:84 -Pro B:85
5Ala B:88 -Asp B:89
6Val B:140 -Pro B:141
7Arg C:84 -Pro C:85
8Ala C:88 -Asp C:89
9Val C:140 -Pro C:141
10Arg D:84 -Pro D:85
11Ala D:88 -Asp D:89
12Val D:140 -Pro D:141

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1V00)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1V00)

(-) Exons   (0, 0)

(no "Exon" information available for 1V00)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:240
 aligned with Q6YD91_ERYCG | Q6YD91 from UniProtKB/TrEMBL  Length:242

    Alignment length:240
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240
         Q6YD91_ERYCG     1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPET 240
               SCOP domains d1v00a_ A: Legume lectin                                                                                                                                                                                                                         SCOP domains
               CATH domains 1v00A00 A:1-240  [code=2.60.120.200, no name defined]                                                                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee.........eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee...........eeeeeeee........hhhhh........hhhhh.eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeee......eeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1v00 A   1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPET 240
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240


Chain B from PDB  Type:PROTEIN  Length:240
 aligned with Q6YD91_ERYCG | Q6YD91 from UniProtKB/TrEMBL  Length:242

    Alignment length:240
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240
         Q6YD91_ERYCG     1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPET 240
               SCOP domains d1v00b_ B: Legume lectin                                                                                                                                                                                                                         SCOP domains
               CATH domains 1v00B00 B:1-240  [code=2.60.120.200, no name defined]                                                                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee.........eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee...........eeeeeeee........hhhhh........hhhhh.eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeee......eeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1v00 B   1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPET 240
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240


Chain C from PDB  Type:PROTEIN  Length:241
 aligned with Q6YD91_ERYCG | Q6YD91 from UniProtKB/TrEMBL  Length:242

    Alignment length:241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240 
         Q6YD91_ERYCG     1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPETN 241
               SCOP domains d1v00c_ C: Legume lectin                                                                                                                                                                                                                          SCOP domains
               CATH domains 1v00C00 C:1-241  [code=2.60.120.200, no name defined]                                                                                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.........eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee...........eeeeeeee........hhhhh........hhhhh.eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeee......eeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1v00 C   1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPETN 241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240 


Chain D from PDB  Type:PROTEIN  Length:240
 aligned with Q6YD91_ERYCG | Q6YD91 from UniProtKB/TrEMBL  Length:242

    Alignment length:240
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240
         Q6YD91_ERYCG     1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPET 240
               SCOP domains d1v00d_ D: Legume lectin                                                                                                                                                                                                                         SCOP domains
               CATH domains 1v00D00 D:1-240  [code=2.60.120.200, no name defined]                                                                                                                                                                                            CATH domains
           Pfam domains (1) -Lectin_legB-1v00D01 D:2-234                                                                                                                                                                                                              ------ Pfam domains (1)
           Pfam domains (2) -Lectin_legB-1v00D02 D:2-234                                                                                                                                                                                                              ------ Pfam domains (2)
           Pfam domains (3) -Lectin_legB-1v00D03 D:2-234                                                                                                                                                                                                              ------ Pfam domains (3)
           Pfam domains (4) -Lectin_legB-1v00D04 D:2-234                                                                                                                                                                                                              ------ Pfam domains (4)
         Sec.struct. author .eeeeeee.........eeeee..ee.....ee..............eeeeee...ee..........eeeeeeeee...........eeeeeeee........hhhhh........hhhhh.eeeeee............eeeeee......eeee.......eeeeeeeee....eeeeeee......eeeeeee.hhhhhh..eeeeeeeeee..........eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1v00 D   1 VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPET 240
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: Concanavalin (293)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q6YD91_ERYCG | Q6YD91)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LAT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:88 - Asp A:89   [ RasMol ]  
    Ala B:88 - Asp B:89   [ RasMol ]  
    Ala C:88 - Asp C:89   [ RasMol ]  
    Ala D:88 - Asp D:89   [ RasMol ]  
    Arg A:84 - Pro A:85   [ RasMol ]  
    Arg B:84 - Pro B:85   [ RasMol ]  
    Arg C:84 - Pro C:85   [ RasMol ]  
    Arg D:84 - Pro D:85   [ RasMol ]  
    Val A:140 - Pro A:141   [ RasMol ]  
    Val B:140 - Pro B:141   [ RasMol ]  
    Val C:140 - Pro C:141   [ RasMol ]  
    Val D:140 - Pro D:141   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1v00
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6YD91_ERYCG | Q6YD91
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6YD91_ERYCG | Q6YD91
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6YD91_ERYCG | Q6YD91: 1uzy 1uzz

(-) Related Entries Specified in the PDB File

1uzy ERYTHRINA CRYSTAGALLI LECTIN
1uzz ERYTHRINA CRISTAGALLI BOUND TO N-LINKED OLIGOSACCHARIDE AND LACTOSE